Entry information : PpaPrx55
Entry ID 7982
Creation 2011-02-07 (Toky Ramarohetra)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx55
Name PpaPrx55
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx55
start..stop
S start..stop
PpaPrx51 649 0 1..321 1..321
PpaPrx29 508 0 1..321 1..323
PpaPrx31 434 3e-154 1..320 1..326
PpaPrx14 335 3e-115 21..320 33..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 638715..638945 231 N° 2 639126..639305 180 N° 3 639370..639924 555  
join(638715..638945,639126..639305,639370..639924)


exon

Literature and cross-references PpaPrx55
DNA ref. Phytozome 12:   scaffold_256 (638715..639924)
Protein sequence: PpaPrx55
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (302)
PWM (Da):   %s   33398.63 (31390.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.86 (6.62) Peptide Signal:   %s   cut: 20 range:20-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRWPSPALLAIFVTIALAMNSITPAAAHTGLKVGFYRHSCPQVEAIVYNSMAQSTKADDTVAPGILRMAFHDCFVRGCDASVLLEGPNTERRARTNTGLHGFDAIDAAKRAVENACPGVVSAADVLQFAxxxxxxxAGGYGWHVPAGRRDGTVSIMEEALNLPAPSMTVSQLIDVFGRKGLSPSQMVVLSGAHTIGKAPCVTFDDRVQTTPVDPTLAPSFATFLKGQCPYAAIQSTSVDMDSTAHTFDSQYFKDIIAGRGLLTSDQSLLYDSRTSGGVYANNGAAFYRNFAKAMVKMSQIEVLTGLDGEIRRQFDQVNSH

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Missing nucleotides between exons 2 and 3. Tandem duplication of PpaPrx51 and 56 or misassembly!!). PpaPrx56 (the same seq and the same position. removed). Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGTGGCCCTCACCGGCGTTACTGGCGATCTTCGTAACCATCGCCCTTGCCATGAATTCAATCACCCCGGCTGCCGCTCACACTGGACTCAAGGTAGGGTTCTATCGTCACAGC
TGTCCCCAAGTGGAGGCCATCGTCTACAACTCTATGGCTCAATCCACCAAGGCCGACGACACCGTTGCACCTGGAATCCTTCGGATGGCGTTCCACGATTGCTTCGTCCGG
GTACGTGAT
CGTCTTGATTTGCAGCACCCCAGCCAGCTGGATCGAGTCGCAGAGCTTGCGCTGAGAAGTACCTGGATTTCAAATTCAGTTTTCCCGAGTTGTCTGCTTCTGCTTCAGATGCTTCACACT
GTAACCGCAACATCTCCTCACAGGATTGTTCCGTCTCTGTGGTTTCTTCAGGGCTGCGACGCTTCCGTTCTGCTAGAAGGACCCAATACAGAGCGAAGAGCTAGAACCAACACGGGACTC
CATGGCTTTGACGCCATCGACGCCGCAAAAAGAGCTGTGGAGAACGCTTGCCCGGGCGTAGTCTCAGCCGCCGATGTGTTGCAGTTCGCCGNNNNNNNNNNNNNNNNNNNN
NNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNCTGACATGTGGATTGCACCTGCGTGGTTGTCCAGGCTGGAGGTTACGGGTGGCATGTGCCCGCTGGGCGTCGAGACGGAACGGTTTCCATCATGGAAGA
AGCACTGAACCTGCCCGCCCCGAGCATGACCGTGTCCCAACTCATAGATGTGTTCGGGCGGAAGGGCTTGAGCCCCTCCCAAATGGTAGTCCTATCAGGTGCCCACACCATCGGAAAAGC
CCCGTGCGTCACATTCGACGACCGCGTTCAGACAACCCCGGTGGACCCAACTCTGGCTCCCAGCTTCGCCACGTTCTTGAAGGGGCAGTGCCCGTATGCAGCAATCCAATCCACCAGCGT
GGACATGGATTCCACCGCGCACACATTCGACAGCCAGTACTTCAAGGACATCATCGCCGGGAGAGGCCTGCTCACCTCGGACCAGAGCCTGTTGTACGACTCCCGCACCAGCGGGGGTGT
GTACGCCAACAACGGCGCGGCATTCTACCGCAACTTCGCCAAGGCGATGGTGAAGATGAGCCAGATTGAGGTGCTCACAGGTTTGGACGGCGAAATTCGGCGACAGTTTGACCAGGTGAA
CAGCCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGTGGCCCTCACCGGCGTTACTGGCGATCTTCGTAACCATCGCCCTTGCCATGAATTCAATCACCCCGGCTGCCGCTCACACTGGACTCAAGGTAGGGTTCTATCGTCACAGC
TGTCCCCAAGTGGAGGCCATCGTCTACAACTCTATGGCTCAATCCACCAAGGCCGACGACACCGTTGCACCTGGAATCCTTCGGATGGCGTTCCACGATTGCTTCGTCCGG
GGCTGCGAC
GCTTCCGTTCTGCTAGAAGGACCCAATACAGAGCGAAGAGCTAGAACCAACACGGGACTCCATGGCTTTGACGCCATCGACGCCGCAAAAAGAGCTGTGGAGAACGCTTGCCCGGGCGTA
GTCTCAGCCGCCGATGTGTTGCAGTTCGCCGNNNNNNNNNNNNNNNNNNNN
GCTGGAGGTTACGGGTGGCATGTGCCCGCTGGGCGTCGAGACGGAACGGTTTCCATCATGGAAGAAGCA
CTGAACCTGCCCGCCCCGAGCATGACCGTGTCCCAACTCATAGATGTGTTCGGGCGGAAGGGCTTGAGCCCCTCCCAAATGGTAGTCCTATCAGGTGCCCACACCATCGGAAAAGCCCCG
TGCGTCACATTCGACGACCGCGTTCAGACAACCCCGGTGGACCCAACTCTGGCTCCCAGCTTCGCCACGTTCTTGAAGGGGCAGTGCCCGTATGCAGCAATCCAATCCACCAGCGTGGAC
ATGGATTCCACCGCGCACACATTCGACAGCCAGTACTTCAAGGACATCATCGCCGGGAGAGGCCTGCTCACCTCGGACCAGAGCCTGTTGTACGACTCCCGCACCAGCGGGGGTGTGTAC
GCCAACAACGGCGCGGCATTCTACCGCAACTTCGCCAAGGCGATGGTGAAGATGAGCCAGATTGAGGTGCTCACAGGTTTGGACGGCGAAATTCGGCGACAGTTTGACCAGGTGAACAGC
CACTAG

Retrieve as FASTA