Entry information : BdiPrx51 (Bradi2g06497)
Entry ID 7985
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-03-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx51 (Bradi2g06497)
Name (synonym) BdiPrx51 (Bradi2g06497)
Class Class III peroxidase    [Orthogroup: Prx157]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx51
start..stop
S start..stop
OsPrx02 446 4e-159 23..327 14..317
ZmPrx119 416 1e-146 28..327 39..342
TaPrx40 404 3e-143 27..280 24..276
SiPrx20 402 1e-141 31..327 28..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4964448..4964669 222 N° 2 4964788..4964979 192 N° 3 4965087..4965656 570  
join(4964448..4964669,4964788..4964979,4965087..4965656)


exon

Literature and cross-references BdiPrx51 (Bradi2g06497)
DNA ref. Phytozome 12:   Bd2 (4964448..4965656)
Protein sequence: BdiPrx51 (Bradi2g06497)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   33601.95 Transmb domain:   %s   i13-32o
PI (pH):   %s   8.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSRASVTAGARVVAVVLAAAVVAVGGQLMPGFYDATCPGLPSLVRRGMAQAVQKEARMGASVLRLFFHDCFVNGCDASILLDDTANSPGEKNAGPNANSVRGYEVIDDIKAHVEASCKATVSCADILALAARDAVNLLGGPSWTVQLGRRDGRDANQYAANQNLPPPDATLPDLLARFRSKGLDARDLTALSGAHTVGWARCATFRAHVYNSSGAAIDAAFAAGLRARACPPAGGGGDGNLAPLEQRAPAAFDNGYFKDLVARRVLLRSDQELYGGGGGATDALVRAYAADGAAFAADFAAAMVKMGSLALTGNSGEVRLNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTAGCAGAGCGTCAGTGACGGCGGGAGCGCGCGTCGTCGCAGTTGTTCTGGCCGCGGCCGTCGTGGCGGTCGGCGGGCAGCTAATGCCGGGGTTCTACGACGCGACGTGCCCGGGG
CTGCCGTCCTTGGTGCGCCGCGGCATGGCGCAGGCGGTGCAGAAGGAGGCGCGCATGGGCGCCTCCGTCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GTACGTCACTTGCTATAC
ACATCCGATCAAGTCGCATCCAAATGCACGTTACGTACCGTCGTGTTTCAGGCCTGGGCATCGCGTACGGGCAGCGTTTCTGATAGAATTCATGGTGCAGGGGTGCGACGCGTCCATCTT
GCTGGACGACACGGCCAACTCCCCTGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGCTACGAGGTCATCGACGACATCAAGGCGCACGTCGAGGCCTCCTGTAAAGCCAC
CGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACGCCGTCAACCTG
GTCCGCTCCTCTCTCATCTCTCTCCCAAGAAACACATGTCCGATCGAGTGAGTTTAGCTAGCTAGTGG
CATTGTTAATTAATCGATCGCGTGGCTGGATGAATGCAGCTCGGGGGCCCGAGCTGGACGGTGCAGCTGGGCCGGCGGGACGGCCGCGACGCGAACCAATACGCGGCGAACCAGAACCTG
CCACCGCCAGACGCGACGCTCCCGGACCTCCTGGCCCGCTTCCGGTCCAAGGGCCTGGACGCCCGCGACCTCACCGCGCTCTCGGGGGCCCACACCGTCGGCTGGGCCCGCTGCGCCACC
TTCCGGGCCCACGTCTACAACAGCAGCGGCGCCGCCATCGACGCCGCATTCGCCGCGGGGCTGCGGGCCAGGGCGTGCCCGCCGGCGGGGGGCGGCGGCGACGGCAACCTGGCCCCGCTC
GAGCAGCGCGCGCCCGCGGCCTTCGACAACGGCTACTTCAAGGACCTCGTCGCCCGCCGCGTGCTGCTGCGGTCCGACCAGGAGCTCTACGGTGGCGGCGGCGGCGCAACGGACGCGCTC
GTGCGGGCCTATGCTGCCGATGGGGCCGCGTTTGCGGCAGACTTCGCCGCGGCTATGGTGAAGATGGGCAGCCTCGCGCTCACCGGGAACAGCGGCGAGGTCCGGCTCAACTGCCGCAGA
GTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTAGCAGAGCGTCAGTGACGGCGGGAGCGCGCGTCGTCGCAGTTGTTCTGGCCGCGGCCGTCGTGGCGGTCGGCGGGCAGCTAATGCCGGGGTTCTACGACGCGACGTGCCCGGGG
CTGCCGTCCTTGGTGCGCCGCGGCATGGCGCAGGCGGTGCAGAAGGAGGCGCGCATGGGCGCCTCCGTCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GGGTGCGACGCGTCCATC
TTGCTGGACGACACGGCCAACTCCCCTGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGCTACGAGGTCATCGACGACATCAAGGCGCACGTCGAGGCCTCCTGTAAAGCC
ACCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACGCCGTCAACCTG
CTCGGGGGCCCGAGCTGGACGGTGCAGCTGGGCCGGCGGGACGGCCGCGACGCGAACCAATACGCG
GCGAACCAGAACCTGCCACCGCCAGACGCGACGCTCCCGGACCTCCTGGCCCGCTTCCGGTCCAAGGGCCTGGACGCCCGCGACCTCACCGCGCTCTCGGGGGCCCACACCGTCGGCTGG
GCCCGCTGCGCCACCTTCCGGGCCCACGTCTACAACAGCAGCGGCGCCGCCATCGACGCCGCATTCGCCGCGGGGCTGCGGGCCAGGGCGTGCCCGCCGGCGGGGGGCGGCGGCGACGGC
AACCTGGCCCCGCTCGAGCAGCGCGCGCCCGCGGCCTTCGACAACGGCTACTTCAAGGACCTCGTCGCCCGCCGCGTGCTGCTGCGGTCCGACCAGGAGCTCTACGGTGGCGGCGGCGGC
GCAACGGACGCGCTCGTGCGGGCCTATGCTGCCGATGGGGCCGCGTTTGCGGCAGACTTCGCCGCGGCTATGGTGAAGATGGGCAGCCTCGCGCTCACCGGGAACAGCGGCGAGGTCCGG
CTCAACTGCCGCAGAGTGAACTGA

Retrieve as FASTA