Entry information : BdiPrx64 (BRADI2G12192)
Entry ID 7987
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: BdiPrx64 (BRADI2G12192)
Name (synonym) BdiPrx64 (BRADI2G12192)
Class Class III peroxidase    [Orthogroup: Prx100]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx64
start..stop
S start..stop
BdiPrx63 551 0 21..353 17..351
ZmPrx101 505 0 19..353 25..368
OsPrx14 504 0 19..353 16..356
SofPrx06 501 2e-179 19..353 25..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10560527..10560757 231 N° 2 10561537..10561962 426 N° 3 10562047..10562451 405  
join(10560527..10560757,10561537..10561962,10562047..10562451)


exon

Literature and cross-references BdiPrx64 (BRADI2G12192)
DNA ref. Phytozome 12:   Bd2 (10560527..10562451)
Protein sequence: BdiPrx64 (BRADI2G12192)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (323)
PWM (Da):   %s   37924.27 (34917.6)  
PI (pH):   %s   6.65 (6.03) Peptide Signal:   %s   cut: 31 range:31-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSRLAGVAPLLLTAVLCLQLPTVSRAQLQVGFYEKTCPDAETLVRQAVAAAFAKNNGIAAGLIRLHFHDCFVRGCDASVLLVSANGMAERDAMPNKPSLRGFEVIDAAKAAVEKSCPLTVSCADIIAFAARDSINLTGQIVYQVPSGRRDGNISLMKDADENLPLPTFTLQQLIHLFAKKTLTAEEMVTLVGAHTIGRSFCSSFLSRIWNNTNPIVDEGLSSGYAKLLRSLCPSTPNNSTTTVIDPSTPTVLDNNYYKLLPLNLGLFFSDNQLRTNAALNASVNTFADSEALWNEKFWKGMIKMGNIEVLTGTQGEIRLNCSVVNKITGMEMAHYYSGSASSVDEIVTS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 3'). Prediction from ensembl (no prediction in phytozome). Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAGCAGCAGCCGGCTGGCTGGCGTAGCGCCGCTGCTGCTGACGGCCGTGCTGTGCCTGCAGCTGCCGACGGTGAGCCGCGCGCAGCTCCAGGTCGGGTTCTACGAGAAGACC
TGCCCCGACGCCGAGACGCTTGTCCGGCAGGCCGTCGCGGCGGCGTTTGCCAAGAACAACGGCATCGCCGCTGGACTCATCCGCCTCCATTTCCATGACTGCTTCGTCCGG
GTAATTGAG
GCCGACATATATTCTTCTATACTCCCTGGTTCCGGATAACATATCACGTTCGCAACCGTCCCCTCATGCAGCACATCGGCATGCCCTGTGCGGCCGTGCCTATGTCTCGTCGTTGCCGGT
CTCTCGCCAGAGACCACCGTAGGATTACACTACCGGCCGTGTGGGTGCGGACCAAAGTTTTTTTTTGTTTATACTTATCACTGCGAATCTCGGAATTTTACGGCCCGATCAAAAGAGTTG
AAATGAATTTCGAATTCAAATGTTAAAATTTGTTAAACAAATTGAATAGGTATCCTAGTCTTTAACAAAGCAAAATGAAATTTAGTGTTAAGTATACATGTAGCCTTCAGTTCTGCGAGG
AGGATCAGGATTCGAAACCCAGCAATCCAGATTTTTCATCTGGTAGGTTAATTGCTCTGGAGGGAATGGAAGAATCCGTGACCGCCAGTTACCGAATACTAGCTGCTCGCCATGGTCTAT
CTCGGAAGAGGAAGAAAAAACTGCACGGGGCAACCATAAAGATATGCACAGCCAAAATTGTCATGGTTGACGATTTGATCCAGCTTGTTAACTATTGACACCATTCATGTCTGAAATTGG
ATTGGGAATCAGACACATAATTTGAGCTTCAATCCAGGGTTGTTGATGCCTCATTGCTTAATCAAACACATCATCGCAACATTAGCGCAGCTAATGAATGTTTGTTTAAAAGTTATTTAT
ATCCCCTAAAACAGTTATTTATATGGCTTGTCCTCTGCTTAACTGTTCAGGGTTGTGACGCCTCAGTGTTGTTGGTGTCTGCGAACGGAATGGCAGAGCGAGACGCTATGCCGAACAAGC
CGAGCCTGCGGGGCTTTGAGGTGATCGACGCTGCCAAGGCCGCTGTCGAGAAGAGTTGTCCACTCACGGTCTCCTGCGCCGACATCATAGCCTTTGCGGCCCGCGACAGCATCAACCTGA
CCGGCCAAATCGTGTACCAGGTCCCCTCCGGTCGCCGTGATGGCAACATCTCCCTCATGAAGGACGCCGACGAAAATCTTCCCCTGCCCACCTTCACCTTGCAGCAGCTCATCCACCTCT
TCGCCAAAAAGACCCTCACTGCAGAGGAGATGGTCACCCTCGTAGGCGCACACACCATCGGCCGTTCCTTCTGCTCCTCCTTCCTCTCCCGCATCTGGAACAACACCAATCCCATT
GTGC
GCACTCTCATTTGCTCATTTCTCATTCATATATATATATGAGCACTGGTTCATCACATCCCATTGTTGATGTACGTGCAGGTGGATGAGGGGCTGAGCTCGGGGTACGCCAAGCTATTGC
GGTCCTTGTGCCCTTCAACCCCGAACAATTCGACGACGACAGTGATCGACCCGAGCACACCGACAGTGCTTGACAACAACTACTACAAGCTGCTGCCGCTCAACCTGGGCCTCTTCTTCT
CCGACAACCAGTTGCGGACCAACGCCGCGCTCAACGCCTCCGTGAACACCTTCGCGGACAGTGAAGCACTCTGGAATGAGAAGTTCTGGAAGGGCATGATCAAGATGGGGAACATCGAGG
TCCTCACGGGGACCCAGGGGGAGATCCGCCTGAACTGCAGTGTCGTCAACAAGATCACTGGGATGGAGATGGCGCACTATTACTCGGGATCCGCCTCCTCCGTTGATGAGATCGTGACGA
GCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAGCAGCAGCCGGCTGGCTGGCGTAGCGCCGCTGCTGCTGACGGCCGTGCTGTGCCTGCAGCTGCCGACGGTGAGCCGCGCGCAGCTCCAGGTCGGGTTCTACGAGAAGACC
TGCCCCGACGCCGAGACGCTTGTCCGGCAGGCCGTCGCGGCGGCGTTTGCCAAGAACAACGGCATCGCCGCTGGACTCATCCGCCTCCATTTCCATGACTGCTTCGTCCGG
GGTTGTGAC
GCCTCAGTGTTGTTGGTGTCTGCGAACGGAATGGCAGAGCGAGACGCTATGCCGAACAAGCCGAGCCTGCGGGGCTTTGAGGTGATCGACGCTGCCAAGGCCGCTGTCGAGAAGAGTTGT
CCACTCACGGTCTCCTGCGCCGACATCATAGCCTTTGCGGCCCGCGACAGCATCAACCTGACCGGCCAAATCGTGTACCAGGTCCCCTCCGGTCGCCGTGATGGCAACATCTCCCTCATG
AAGGACGCCGACGAAAATCTTCCCCTGCCCACCTTCACCTTGCAGCAGCTCATCCACCTCTTCGCCAAAAAGACCCTCACTGCAGAGGAGATGGTCACCCTCGTAGGCGCACACACCATC
GGCCGTTCCTTCTGCTCCTCCTTCCTCTCCCGCATCTGGAACAACACCAATCCCATT
GTGGATGAGGGGCTGAGCTCGGGGTACGCCAAGCTATTGCGGTCCTTGTGCCCTTCAACCCCG
AACAATTCGACGACGACAGTGATCGACCCGAGCACACCGACAGTGCTTGACAACAACTACTACAAGCTGCTGCCGCTCAACCTGGGCCTCTTCTTCTCCGACAACCAGTTGCGGACCAAC
GCCGCGCTCAACGCCTCCGTGAACACCTTCGCGGACAGTGAAGCACTCTGGAATGAGAAGTTCTGGAAGGGCATGATCAAGATGGGGAACATCGAGGTCCTCACGGGGACCCAGGGGGAG
ATCCGCCTGAACTGCAGTGTCGTCAACAAGATCACTGGGATGGAGATGGCGCACTATTACTCGGGATCCGCCTCCTCCGTTGATGAGATCGTGACGAGCTGA

Retrieve as FASTA