Entry information : BdiPrx16 (BRADI1G20027 / Bradi1g20030)
Entry ID 7991
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx16 (BRADI1G20027 / Bradi1g20030)
Name (synonym) BdiPrx16 (BRADI1G20027 / Bradi1g20030)
Class Class III peroxidase     [Orthogroup: Prx069]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx16
start..stop
S start..stop
BdiPrx143 530 0 1..266 86..352
OsPrx106-2 344 4e-119 2..264 123..384
OsPrx106-1 344 4e-119 2..264 123..384
ZmPrx63 342 9e-119 2..264 81..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16029847..16029891 45 N° 2 16029984..16030739 756  
join(16029847..16029891,16029984..16030739)


exon

Literature and cross-references BdiPrx16 (BRADI1G20027 / Bradi1g20030)
DNA ref. Phytozome 12:   Bd1 (16029847..16030739)
Protein sequence: BdiPrx16 (BRADI1G20027 / Bradi1g20030)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   266 (247)
PWM (Da):   %s   28492.06 (26326.0)  
PI (pH):   %s   5.12 (4.92) Peptide Signal:   %s   cut: 20 range:20-266
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGLIRLFFHDCFIRGCDASVLLDQTDPNNPPEKLGVPNLTLRGFEVIDMANAKILEACGNVVSCADILAFTGRDATFFLSGRKVDFDMPAGRFDGNVSLASETLPNLPPPFATVNDLKANFASKGLTADEMVTLSGAHTVGVSHCSSFSSRLTSTSDMEPGLKSSLQSQCSSNTGSDNTVAQDLRTPDQLDNQYYKNVLNRQVLFESDAALLKATDTSAAVRANAGDTGQWEEKFKAAMVKMGAIEVKSRANGEIRRNCRVVNTR*

Retrieve as FASTA  
Remarks Partial sequence from genomic (chromo 1, intron 1). Partial prediction from ensembl (Incomplete sequencing: 5'missing). Incorrect prediction from phytozome( end of exon 3 and exon 4),
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGGCTCATCCGTCTCTTCTTCCACGACTGCTTCATCAGGGTAAGATTTCTCTTGCTAATGCATTTTCATGCAAACAAATATCACCATTTAACGTGATTTACCGTTGATCGACGG
TTGACCGTTACCTGCAGGGTTGCGATGCCTCCGTGCTGCTTGACCAGACCGATCCCAACAACCCGCCGGAGAAGCTCGGCGTCCCAAACCTGACCTTGCGAGGGTTCGAGGTGATCGACA
TGGCCAACGCCAAGATCCTGGAGGCGTGCGGCAACGTCGTCTCATGCGCCGACATCCTGGCCTTCACGGGCCGCGATGCCACCTTCTTCCTCAGCGGCAGGAAGGTCGACTTCGACATGC
CTGCCGGCCGCTTCGACGGGAACGTGTCCTTGGCCAGTGAGACGCTCCCAAACCTGCCGCCGCCATTCGCCACCGTGAATGACCTGAAGGCCAATTTCGCCTCCAAGGGGCTCACCGCCG
ACGAGATGGTCACCCTCTCCGGCGCGCACACCGTCGGAGTCTCCCACTGCTCGTCCTTCTCCAGCCGCCTCACCAGCACTTCCGACATGGAACCCGGGCTCAAAAGCTCCCTCCAGAGTC
AATGCAGTTCCAACACCGGCAGCGACAACACTGTCGCACAGGACTTGAGGACCCCCGACCAGCTGGACAACCAGTACTACAAGAACGTGCTCAACCGCCAGGTGCTCTTCGAGTCAGATG
CCGCGCTCTTGAAGGCGACGGACACAAGCGCGGCTGTCCGCGCCAACGCCGGGGACACGGGCCAGTGGGAGGAGAAGTTCAAGGCAGCAATGGTGAAGATGGGTGCCATCGAAGTCAAGA
GCAGAGCCAACGGCGAGATCAGGAGGAACTGCCGCGTCGTTAACACAAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGGCTCATCCGTCTCTTCTTCCACGACTGCTTCATCAGGGGTTGCGATGCCTCCGTGCTGCTTGACCAGACCGATCCCAACAACCCGCCGGAGAAGCTCGGCGTCCCAAACCTG
ACCTTGCGAGGGTTCGAGGTGATCGACATGGCCAACGCCAAGATCCTGGAGGCGTGCGGCAACGTCGTCTCATGCGCCGACATCCTGGCCTTCACGGGCCGCGATGCCACCTTCTTCCTC
AGCGGCAGGAAGGTCGACTTCGACATGCCTGCCGGCCGCTTCGACGGGAACGTGTCCTTGGCCAGTGAGACGCTCCCAAACCTGCCGCCGCCATTCGCCACCGTGAATGACCTGAAGGCC
AATTTCGCCTCCAAGGGGCTCACCGCCGACGAGATGGTCACCCTCTCCGGCGCGCACACCGTCGGAGTCTCCCACTGCTCGTCCTTCTCCAGCCGCCTCACCAGCACTTCCGACATGGAA
CCCGGGCTCAAAAGCTCCCTCCAGAGTCAATGCAGTTCCAACACCGGCAGCGACAACACTGTCGCACAGGACTTGAGGACCCCCGACCAGCTGGACAACCAGTACTACAAGAACGTGCTC
AACCGCCAGGTGCTCTTCGAGTCAGATGCCGCGCTCTTGAAGGCGACGGACACAAGCGCGGCTGTCCGCGCCAACGCCGGGGACACGGGCCAGTGGGAGGAGAAGTTCAAGGCAGCAATG
GTGAAGATGGGTGCCATCGAAGTCAAGAGCAGAGCCAACGGCGAGATCAGGAGGAACTGCCGCGTCGTTAACACAAGATAG

Retrieve as FASTA