Entry information : BdiPrx53 (BRADI2G09650)
Entry ID 7992
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx53 (BRADI2G09650)
Name (synonym) BdiPrx53 (BRADI2G09650)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx53
start..stop
S start..stop
SiPrx10 608 0 1..346 1..345
OsPrx05 603 0 1..346 1..345
SbPrx52 593 0 1..346 1..345
ZmPrx46 577 0 1..346 1..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7927086..7927352 267 N° 2 7926702..7926893 192 N° 3 7926359..7926524 166 N° 4 7925551..7925972 422
complement(join(7925551..7925972,7926359..7926524,7926702..7926893,7927086..7927 352))


exon

Literature and cross-references BdiPrx53 (BRADI2G09650)
DNA ref. Phytozome 12:   Bd2 (7927352..7925551)
Protein sequence: BdiPrx53 (BRADI2G09650)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (325)
PWM (Da):   %s   38372.72 (36015.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.7 (8.55) Peptide Signal:   %s   cut: 24 range:24-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSKALLGAIFIASFYFPASIAFPAHHEGAHPVGHSPKPKLGLSPDFYISTCPQADEIVVSVLKKAIAKEQRIAASLLRLLFHDCFVQGCDASVLLDDSKADASEKNAIPNKNSLRGFEVIDEIKAALEEACPHTVSCADTVALAARGSTVLSGGPYWELPLGRRDSKTAYMKLANKNLPPPNATLHRLIKFFERQGLDKVDLVALSGSHTIGMARCVSFKQRLYNQHRDNKPDMTLEKRFYYTLASVCPRTGGDNNISPLDFVSPSKFDNSYYKLILEGKGLLNSDQVLWTGKDQKIADLVRSYAENESLFFEHYVNSIIKMGNRNPLLGHDGEIRKNCRRVNQVL

Retrieve as FASTA  
Remarks Prediction from phytozome (and ensembl).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCCAAGGCATTGCTTGGTGCAATCTTCATTGCCTCTTTCTACTTCCCAGCCTCTATTGCATTCCCTGCTCACCATGAGGGCGCTCATCCAGTTGGACACAGTCCAAAGCCA
AAGCTAGGTCTTTCTCCAGATTTCTATATATCCACATGCCCACAAGCTGATGAGATTGTGGTCTCCGTCTTGAAGAAGGCGATCGCCAAGGAACAGCGGATAGCTGCCTCCCTTCTCAGG
CTCCTTTTTCATGACTGCTTTGTTCAG
GTATGCACATTGCATATGTTTTTGGGCATGAAGTAAACAAAGTTCCTATAGCCACATAGTTCACCACCAGTCGAAAATACTGCATGTTCTTAA
GAACTGGAACACCATGATTTCAGGCTCACCACTCATAATCTAGATCGCCTACTTATGCGTTAGTGCTATATATCAGAACTGGTTTCGCTCAAATTGCAGGGGTGCGATGCATCAGTTCTG
CTGGATGACAGCAAGGCAGACGCAAGCGAGAAAAACGCTATTCCCAACAAGAATTCTCTCAGGGGATTTGAAGTCATAGATGAGATCAAAGCTGCACTTGAAGAAGCATGTCCACACACA
GTCTCCTGTGCTGACACTGTTGCCCTAGCTGCCAGAGGTTCAACAGTATTG
GTAAATATCTGCTCTTCATGTTCATAAACATGTGTTAGACTGTTAGTTGTAGGGCAAAATAGAAATTTT
CTCGAATTGCTTTGTTTTATCTTATTTAGAGGACTAAAAACTACTGGTGTCCGTAAGTAAATATCTGCTATTGGTTTACACATACCTGACCATGGCATCTCATGACAGAGTGGTGGCCCA
TATTGGGAACTTCCGCTAGGTAGGAGGGATTCAAAGACAGCATATATGAAGCTTGCTAATAAGAACCTTCCTCCACCAAATGCAACACTGCATCGTCTCATAAAATTCTTTGAAAGGCAA
GGACTGGATAAAGTGGACCTTGTAGCACTATCAG
GTATGGCACCTCATCAAATGTTCAAAGTACACATTGAGGTAAAAAGGTTTGATAGGAATGTTAAATAGCCTAGAAGTGGCTTGGTT
GCTCGTATTCTCTACACCGGCTTTCTTGTCATAAGCTTGGGCTTGAACAGATACCAAGAGAAACATATAGTGGATCAAGAAAAGGCATTAAAGTTGTCAGTAAAAATAATATCTGCTAGA
AAAAGATGATTGCAACAACATAAAACAACAATATTCAGATCATAATCATATTGGATGTTCTAGTCAGATCATCATTGTAGTTTTTGAAATTTGACAGTGCAGTTTCAAATGCATTTCGAC
AAATATATTGGATCGGCATATTGTTCATCTCAACGATACATCTATCTTGCCTTTCAACAGGTAGCCACACCATTGGAATGGCTAGATGTGTGAGTTTCAAACAACGACTCTACAATCAGC
ACAGAGATAACAAACCGGACATGACACTGGAGAAAAGGTTTTACTACACGCTGGCATCAGTCTGTCCACGCACTGGAGGTGATAACAACATAAGCCCACTAGACTTCGTCAGCCCTTCGA
AATTTGACAACAGCTACTACAAGTTGATATTGGAAGGAAAAGGTCTTCTTAATTCAGATCAGGTTTTGTGGACCGGAAAAGACCAAAAAATAGCAGATCTGGTCAGAAGTTATGCAGAAA
ATGAATCATTGTTCTTTGAACACTATGTGAACTCAATAATCAAAATGGGGAACAGAAATCCCCTCTTGGGTCATGATGGAGAAATACGCAAGAACTGTCGGAGGGTTAATCAAGTCCTCT
AG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCATCCAAGGCATTGCTTGGTGCAATCTTCATTGCCTCTTTCTACTTCCCAGCCTCTATTGCATTCCCTGCTCACCATGAGGGCGCTCATCCAGTTGGACACAGTCCAAAGCCA
AAGCTAGGTCTTTCTCCAGATTTCTATATATCCACATGCCCACAAGCTGATGAGATTGTGGTCTCCGTCTTGAAGAAGGCGATCGCCAAGGAACAGCGGATAGCTGCCTCCCTTCTCAGG
CTCCTTTTTCATGACTGCTTTGTTCAG
GGGTGCGATGCATCAGTTCTGCTGGATGACAGCAAGGCAGACGCAAGCGAGAAAAACGCTATTCCCAACAAGAATTCTCTCAGGGGATTTGAA
GTCATAGATGAGATCAAAGCTGCACTTGAAGAAGCATGTCCACACACAGTCTCCTGTGCTGACACTGTTGCCCTAGCTGCCAGAGGTTCAACAGTATTG
AGTGGTGGCCCATATTGGGAA
CTTCCGCTAGGTAGGAGGGATTCAAAGACAGCATATATGAAGCTTGCTAATAAGAACCTTCCTCCACCAAATGCAACACTGCATCGTCTCATAAAATTCTTTGAAAGGCAAGGACTGGAT
AAAGTGGACCTTGTAGCACTATCAG
GTAGCCACACCATTGGAATGGCTAGATGTGTGAGTTTCAAACAACGACTCTACAATCAGCACAGAGATAACAAACCGGACATGACACTGGAGAAA
AGGTTTTACTACACGCTGGCATCAGTCTGTCCACGCACTGGAGGTGATAACAACATAAGCCCACTAGACTTCGTCAGCCCTTCGAAATTTGACAACAGCTACTACAAGTTGATATTGGAA
GGAAAAGGTCTTCTTAATTCAGATCAGGTTTTGTGGACCGGAAAAGACCAAAAAATAGCAGATCTGGTCAGAAGTTATGCAGAAAATGAATCATTGTTCTTTGAACACTATGTGAACTCA
ATAATCAAAATGGGGAACAGAAATCCCCTCTTGGGTCATGATGGAGAAATACGCAAGAACTGTCGGAGGGTTAATCAAGTCCTCTAG

Retrieve as FASTA