Entry information : BdiPrx104 (Bradi3g13590)
Entry ID 7994
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx104 (Bradi3g13590)
Name (synonym) BdiPrx104 (Bradi3g13590)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx104
start..stop
S start..stop
OsPrx117 469 2e-168 4..319 1..315
SiPrx65 464 2e-166 1..320 1..319
SbPrx102 457 1e-163 27..320 26..319
ZmPrx15 457 2e-163 27..320 29..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12103330..12103554 225 N° 2 12103669..12104409 741  
join(12103330..12103554,12103669..12104409)


exon

Literature and cross-references BdiPrx104 (Bradi3g13590)
DNA ref. Phytozome 12:   Bd3 (12103330..12104409)
Protein sequence: BdiPrx104 (Bradi3g13590)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321
PWM (Da):   %s   34097.08 Transmb domain:   %s   i7-29o
PI (pH):   %s   5.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAVKDLVRLLILVEVAIAVAGPATTVAALSVDYYAMGCPFAEYMVRDVVNKAVMADPTLAAGLLRLHFHDCFVQGCDASVLLDSTPKNTAEKDAPANKSLRGFEVIDKIKQILESQCPGVVSCADILALAARDAVLAAGGPYYMVPVGRRDGSRSVFTDTFTALPSPFLNASALTALFATHGFDVQDMVALSGGHTLGVAHCASFKNRIAAETSTLESGLAASLAGTCAKGDSATAAFDRTSTAFDGVYFKELQQRRGLLTSDQTLFESPETQMLVNTFAMNQAYFFYAFQQGMYKMGQIDLKEGTQGEVRKSCRVVNSY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCGTCAAGGACCTTGTGAGGCTCTTGATCCTCGTGGAGGTGGCCATCGCCGTGGCAGGGCCGGCCACCACCGTGGCGGCGCTGAGCGTAGACTACTACGCCATGGGGTGCCCG
TTCGCGGAGTACATGGTCCGGGACGTGGTGAACAAGGCCGTCATGGCTGACCCTACCCTCGCCGCCGGCCTCCTCCGCCTCCACTTCCATGACTGCTTCGTCCAG
GTATGCATATATATG
CATGCATGTTTTTTCCCTCGAAATTCAAAAAGGTCAGGATATCCTGTTTTTCTTATGGCTTCAATATAACATATAATCCATGGAATCGGTCGATTTCAGGGATGCGACGCGTCGGTGCTG
CTGGACTCGACGCCGAAGAACACGGCGGAGAAGGACGCGCCGGCCAACAAGAGCCTGCGCGGGTTCGAGGTCATCGACAAGATCAAGCAGATCCTCGAGTCCCAATGCCCCGGCGTCGTC
TCCTGCGCCGACATCCTCGCATTGGCGGCCCGTGACGCCGTGCTCGCCGCGGGTGGGCCATACTACATGGTGCCCGTGGGCCGGCGCGACGGTTCCCGCTCCGTCTTCACCGACACCTTC
ACGGCGCTCCCTTCCCCGTTCCTCAACGCCTCCGCCCTGACCGCCCTCTTCGCCACCCACGGCTTCGACGTCCAGGACATGGTGGCGCTCTCCGGCGGGCACACGCTCGGGGTGGCCCAC
TGCGCGTCGTTCAAGAACCGGATCGCCGCCGAGACGTCCACGCTGGAGAGCGGCCTGGCGGCGTCGCTGGCCGGCACCTGCGCCAAGGGGGACTCGGCGACGGCGGCGTTCGACCGGACC
AGCACCGCCTTCGACGGGGTCTACTTCAAGGAGCTGCAGCAGAGGAGGGGCCTCCTGACCTCCGACCAGACGCTGTTCGAGTCGCCGGAGACGCAGATGCTCGTCAATACGTTCGCCATG
AACCAGGCCTACTTCTTCTACGCGTTCCAGCAAGGGATGTACAAGATGGGGCAGATTGATCTCAAGGAGGGGACTCAGGGCGAGGTCAGGAAATCATGCAGGGTCGTCAACTCATACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCGTCAAGGACCTTGTGAGGCTCTTGATCCTCGTGGAGGTGGCCATCGCCGTGGCAGGGCCGGCCACCACCGTGGCGGCGCTGAGCGTAGACTACTACGCCATGGGGTGCCCG
TTCGCGGAGTACATGGTCCGGGACGTGGTGAACAAGGCCGTCATGGCTGACCCTACCCTCGCCGCCGGCCTCCTCCGCCTCCACTTCCATGACTGCTTCGTCCAG
GGATGCGACGCGTCG
GTGCTGCTGGACTCGACGCCGAAGAACACGGCGGAGAAGGACGCGCCGGCCAACAAGAGCCTGCGCGGGTTCGAGGTCATCGACAAGATCAAGCAGATCCTCGAGTCCCAATGCCCCGGC
GTCGTCTCCTGCGCCGACATCCTCGCATTGGCGGCCCGTGACGCCGTGCTCGCCGCGGGTGGGCCATACTACATGGTGCCCGTGGGCCGGCGCGACGGTTCCCGCTCCGTCTTCACCGAC
ACCTTCACGGCGCTCCCTTCCCCGTTCCTCAACGCCTCCGCCCTGACCGCCCTCTTCGCCACCCACGGCTTCGACGTCCAGGACATGGTGGCGCTCTCCGGCGGGCACACGCTCGGGGTG
GCCCACTGCGCGTCGTTCAAGAACCGGATCGCCGCCGAGACGTCCACGCTGGAGAGCGGCCTGGCGGCGTCGCTGGCCGGCACCTGCGCCAAGGGGGACTCGGCGACGGCGGCGTTCGAC
CGGACCAGCACCGCCTTCGACGGGGTCTACTTCAAGGAGCTGCAGCAGAGGAGGGGCCTCCTGACCTCCGACCAGACGCTGTTCGAGTCGCCGGAGACGCAGATGCTCGTCAATACGTTC
GCCATGAACCAGGCCTACTTCTTCTACGCGTTCCAGCAAGGGATGTACAAGATGGGGCAGATTGATCTCAAGGAGGGGACTCAGGGCGAGGTCAGGAAATCATGCAGGGTCGTCAACTCA
TACTAG

Retrieve as FASTA