Entry information : BdiPrx74 (BRADI2G34717)
Entry ID 7996
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: BdiPrx74 (BRADI2G34717)
Name (synonym) BdiPrx74 (BRADI2G34717)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx74
start..stop
S start..stop
OsPrx72 496 3e-178 11..338 3..335
SbPrx116 494 4e-177 2..330 11..340
ZmPrx39 489 2e-175 11..330 7..333
SpPrx01 487 1e-174 22..339 20..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34801138..34801353 216 N° 2 34800576..34801007 432 N° 3 34800111..34800482 372  
complement(join(34800111..34800482,34800576..34801007,34801138..34801353))


exon

Literature and cross-references BdiPrx74 (BRADI2G34717)
DNA ref. Phytozome 12:   Bd2 (34801353..34800111)
Protein sequence: BdiPrx74 (BRADI2G34717)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (314)
PWM (Da):   %s   35833.01 (33359.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.12 (5.34) Peptide Signal:   %s   cut: 26 range:26-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRFSSLASALAVVTLAAWTAAVGACIDVGFYDQTCPSAEALVQQTVAAAFVNDSGVAPALIRLHFHDCFVKGCDGSVLIDSTPGNRAEKDSAANNPSLRFFDVVDRAKAAVEAACPGVVSCADVLAFAARDSVVLSGGLGYQVPSGRRDGQVSTEQNADDNLPGPTSTASQLATGFARKNLTLDDIVILSGAHTIGVSHCSSFTDRLYNFNSSDKIDPALSKAYAFLLKGICPPNSNQTFPTMTTLMDLMTPVRFDNKYYLGLVNNLGLFESDAALLTNTTMRALVDSFVSSEAAFKTAFARSMIKLGQIEVLSRSQGEIRRNCRVINPTTTQLVAAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo2, intron 1 and 3'). Prediction from ensembl. Incorrect prediction from phytozome (bradi2g34720). Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCGCTTCTCCAGCTTGGCCTCGGCGCTCGCCGTCGTGACCCTGGCAGCCTGGACCGCCGCCGTGGGCGCCTGCATCGACGTCGGCTTCTACGACCAGACCTGCCCATCGGCCGAG
GCCCTGGTGCAGCAGACCGTCGCCGCCGCCTTCGTCAATGACTCCGGCGTTGCTCCGGCCCTCATCCGCCTCCACTTCCACGACTGCTTCGTCAAA
GTGAGCCACCACACGCATGCTCCC
TGCCCGAGTTTTATGATATTGTAAAAGCTCAAACTGATTAGGATAGGACAACATGCAATTCATTTATACTTACAGCTGACATGCATGGCTACCCGTTGGCATGCAGGGGTGCGACGGGTC
GGTGCTGATCGACTCGACGCCGGGGAACAGGGCGGAGAAGGACTCGGCGGCCAACAACCCAAGCCTCCGCTTCTTCGACGTGGTGGACCGTGCCAAGGCGGCCGTGGAGGCGGCGTGCCC
TGGTGTGGTCTCCTGCGCCGACGTCCTGGCCTTCGCAGCGCGGGACAGTGTCGTGCTCTCCGGCGGCCTCGGCTACCAGGTGCCCTCGGGCCGCCGCGACGGCCAGGTCTCCACGGAGCA
GAATGCCGACGATAACCTCCCCGGCCCGACCTCCACCGCCTCCCAGCTTGCCACCGGCTTCGCCCGCAAGAACCTCACCCTCGACGACATCGTCATTCTCTCCGGCGCCCACACCATCGG
CGTCTCCCACTGCAGCAGCTTCACCGACCGCCTCTACAATTTCAACTCATCCGACAAA
GTAATAATATAATCATTCAACAACAAAACACATAATCCAAAAGAGATATACTATATTATCAT
CATAATACACGAATTGATTCCTTATTTTCAGATTGATCCGGCGCTGAGCAAGGCGTACGCGTTCCTGCTGAAGGGCATCTGCCCGCCGAACAGCAACCAGACGTTCCCGACGATGACGAC
GCTGATGGACCTGATGACGCCGGTGAGGTTCGACAACAAATACTACCTGGGGCTCGTCAACAACCTGGGCCTCTTCGAGTCTGATGCGGCGCTGCTGACCAACACCACCATGAGAGCACT
GGTGGACTCCTTCGTGAGCAGCGAGGCTGCGTTCAAGACGGCTTTCGCACGGTCCATGATCAAGCTGGGCCAGATTGAGGTGCTCTCCAGGTCGCAGGGCGAGATCAGGCGCAACTGCAG
GGTCATCAACCCTACCACCACCCAGCTGGTGGCTGCGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCGCTTCTCCAGCTTGGCCTCGGCGCTCGCCGTCGTGACCCTGGCAGCCTGGACCGCCGCCGTGGGCGCCTGCATCGACGTCGGCTTCTACGACCAGACCTGCCCATCGGCCGAG
GCCCTGGTGCAGCAGACCGTCGCCGCCGCCTTCGTCAATGACTCCGGCGTTGCTCCGGCCCTCATCCGCCTCCACTTCCACGACTGCTTCGTCAAA
GGGTGCGACGGGTCGGTGCTGATC
GACTCGACGCCGGGGAACAGGGCGGAGAAGGACTCGGCGGCCAACAACCCAAGCCTCCGCTTCTTCGACGTGGTGGACCGTGCCAAGGCGGCCGTGGAGGCGGCGTGCCCTGGTGTGGTC
TCCTGCGCCGACGTCCTGGCCTTCGCAGCGCGGGACAGTGTCGTGCTCTCCGGCGGCCTCGGCTACCAGGTGCCCTCGGGCCGCCGCGACGGCCAGGTCTCCACGGAGCAGAATGCCGAC
GATAACCTCCCCGGCCCGACCTCCACCGCCTCCCAGCTTGCCACCGGCTTCGCCCGCAAGAACCTCACCCTCGACGACATCGTCATTCTCTCCGGCGCCCACACCATCGGCGTCTCCCAC
TGCAGCAGCTTCACCGACCGCCTCTACAATTTCAACTCATCCGACAAA
ATTGATCCGGCGCTGAGCAAGGCGTACGCGTTCCTGCTGAAGGGCATCTGCCCGCCGAACAGCAACCAGACG
TTCCCGACGATGACGACGCTGATGGACCTGATGACGCCGGTGAGGTTCGACAACAAATACTACCTGGGGCTCGTCAACAACCTGGGCCTCTTCGAGTCTGATGCGGCGCTGCTGACCAAC
ACCACCATGAGAGCACTGGTGGACTCCTTCGTGAGCAGCGAGGCTGCGTTCAAGACGGCTTTCGCACGGTCCATGATCAAGCTGGGCCAGATTGAGGTGCTCTCCAGGTCGCAGGGCGAG
ATCAGGCGCAACTGCAGGGTCATCAACCCTACCACCACCCAGCTGGTGGCTGCGAGCTGA

Retrieve as FASTA