Entry information : BdiPrx143
Entry ID 7998
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx143
Name BdiPrx143
Class Class III peroxidase     [Orthogroup: Prx069]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx143
start..stop
S start..stop
BdiPrx16 534 0 86..352 1..266
ZmPrx63 372 3e-129 58..350 52..349
SbPrx35 365 2e-125 58..350 116..411
OsPrx106-1 362 8e-125 57..350 90..384
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34..335 302 N° 2 430..1186 757  
join(34..335,430..1186)


exon

Literature and cross-references BdiPrx143
DNA ref. Phytozome 12:   scaffold_124 (291..1186)
Protein sequence: BdiPrx143
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352
PWM (Da):   %s   36663.27  
PI (pH):   %s   5.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PPAPISTPSPPPPTPSPPPPSPISTPSPPPPTPSPPPPPPSTPSPPLPTPSPLPPQGLTVGHYNNICLQAEAIVRNAVSAASAGTMAGLIRLFFHDCFIRGCDASVLLDQTDPNNPPEKLGVPNLTLRGFEVIDAASAKILEACGNVVSCADILAFASRDATFFLSGRKVDFDMPAGRFDGNVSLASETLPNLPPPFATVNDLKANFASKGLTADEMVTLSGAHTIGVSHCSSFSSRLTSTSDMEPGLKSSLQSQCSSNTGSDxNTVSQDLRTPDQLDNQYYKNVLSRQVLFESDAALLTATDTSAAVRANAGDTGQWEEKFKAAMVKMGAIEVKSRANGEIRRSCRVVNTR

Retrieve as FASTA  
Remarks Partial sequence from genomic (unknown chromo, intron 1). No transcript predicted from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTCCCGCCCCAATAAGCACACCGAGCCCACCGCCACCCACACCTAGCCCTCCGCCGCCCTCCCCGATAAGCACACCGAGCCCACCGCCGCCAACACCTAGCCCTCCGCCTCCTCCACCA
TCCACGCCTAGCCCCCCGCTGCCGACCCCGAGCCCACTGCCTCCACAGGGACTCACCGTCGGCCACTACAACAATATATGTCTCCAAGCAGAAGCCATTGTCAGAAATGCTGTCAGTGCG
GCTAGCGCCGGCACCATGGCCGGGCTCATCCGTCTCTTCTTCCATGACTGCTTCATCCGGGT
AAGATTTATCTTGCTAATGCATTTTCATGCATATGCATGCAAACAAATATCACCATAT
ATACCGTTGATCGACGGTTGAACGTTACCTGCAGGGTTGCGATGCCTCCGTGCTGCTTGACCAGACCGATCCCAACAACCCGCCGGAGAAGCTCGGCGTCCCAAACCTGACCTTGCGAGG
GTTCGAGGTGATCGACGCGGCCAGCGCCAAGATCCTGGAGGCATGCGGCAATGTCGTCTCATGCGCCGACATCCTGGCCTTCGCCAGCCGCGACGCCACCTTCTTCCTCAGCGGCAGGAA
GGTCGACTTCGACATGCCTGCCGGCCGCTTCGACGGGAACGTGTCCTTGGCCAGCGAGACGCTCCCGAACCTGCCGCCGCCATTCGCCACCGTGAACGACCTCAAGGCCAATTTTGCCTC
CAAGGGGCTCACCGCCGACGAGATGGTCACCCTCTCCGGCGCACACACCATCGGAGTCTCCCACTGCTCGTCCTTCTCCAGCCGCCTCACCAGCACTTCCGACATGGAACCTGGGCTCAA
AAGCTCCCTGCAGAGTCAATGCAGTTCCAACACCGGCAGCGACANNAACACGGTCTCACAAGACTTGAGGACCCCCGACCAGCTGGACAACCAGTACTACAAGAACGTGCTCAGCCGCCA
GGTGCTCTTCGAGTCAGACGCCGCGCTCTTGACGGCGACGGACACAAGCGCGGCAGTGCGCGCCAACGCCGGGGACACGGGCCAGTGGGAGGAGAAGTTCAAGGCAGCCATGGTGAAGAT
GGGTGCCATCGAGGTCAAGAGCAGAGCCAACGGCGAGATCAGGAGGAGCTGTCGCGTCGTTAACACAAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTCCCGCCCCAATAAGCACACCGAGCCCACCGCCACCCACACCTAGCCCTCCGCCGCCCTCCCCGATAAGCACACCGAGCCCACCGCCGCCAACACCTAGCCCTCCGCCTCCTCCACCA
TCCACGCCTAGCCCCCCGCTGCCGACCCCGAGCCCACTGCCTCCACAGGGACTCACCGTCGGCCACTACAACAATATATGTCTCCAAGCAGAAGCCATTGTCAGAAATGCTGTCAGTGCG
GCTAGCGCCGGCACCATGGCCGGGCTCATCCGTCTCTTCTTCCATGACTGCTTCATCCGGGT
TTGCGATGCCTCCGTGCTGCTTGACCAGACCGATCCCAACAACCCGCCGGAGAAGCTC
GGCGTCCCAAACCTGACCTTGCGAGGGTTCGAGGTGATCGACGCGGCCAGCGCCAAGATCCTGGAGGCATGCGGCAATGTCGTCTCATGCGCCGACATCCTGGCCTTCGCCAGCCGCGAC
GCCACCTTCTTCCTCAGCGGCAGGAAGGTCGACTTCGACATGCCTGCCGGCCGCTTCGACGGGAACGTGTCCTTGGCCAGCGAGACGCTCCCGAACCTGCCGCCGCCATTCGCCACCGTG
AACGACCTCAAGGCCAATTTTGCCTCCAAGGGGCTCACCGCCGACGAGATGGTCACCCTCTCCGGCGCACACACCATCGGAGTCTCCCACTGCTCGTCCTTCTCCAGCCGCCTCACCAGC
ACTTCCGACATGGAACCTGGGCTCAAAAGCTCCCTGCAGAGTCAATGCAGTTCCAACACCGGCAGCGACANNAACACGGTCTCACAAGACTTGAGGACCCCCGACCAGCTGGACAACCAG
TACTACAAGAACGTGCTCAGCCGCCAGGTGCTCTTCGAGTCAGACGCCGCGCTCTTGACGGCGACGGACACAAGCGCGGCAGTGCGCGCCAACGCCGGGGACACGGGCCAGTGGGAGGAG
AAGTTCAAGGCAGCCATGGTGAAGATGGGTGCCATCGAGGTCAAGAGCAGAGCCAACGGCGAGATCAGGAGGAGCTGTCGCGTCGTTAACACAAGATAG

Retrieve as FASTA