Entry information : ZmPrx37
Entry ID 800
Creation 2005-12-19 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: ZmPrx37
Name ZmPrx37
Class Class III peroxidase    [Orthogroup: Prx115]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx37
start..stop
S start..stop
SofPrx08 544 0 1..321 1..324
SbPrx71 518 0 1..321 1..325
SiPrx76 517 0 26..321 31..325
OsPrx27 487 2e-175 23..321 27..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145526072..145526281 210 N° 2 145525772..145525963 192 N° 3 145524680..145525243 564  
complement(join(145524680..145525243,145525772..145525963,145526072..145526281))


exon

Literature and cross-references ZmPrx37
Literature Hunter,B.G. et al., unpublished
Protein sequence: ZmPrx37
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   33035.59 (30842.4)  
PI (pH):   %s   8.14 (7.98) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPATLLLARLAVACALALGAMAQLSPTFYDASCPSLQAIVRAGMAAAVQQEPRMGASILRLFFHDCFVQGCDASVLLDDSPTLTGEKNAGPNANSLRGFEVIDSIKSQVEAACPGTVSCADILALAARDGVNLLSGPTWAVQLGRRDTRTASQSAANSNLPSPSSSAAALVSAFASKGLDSRDLVALSGAHTIGAARCATFRSRVYNDTNISAGFAAKRRQICQAQAGASDGNLAPLDAMSSVRFDNGYFRNLVAQFGLLHSDQELFGAGGGAVDFITAQYARNGAAFSRDFVTAVLKMGSIGPLTGSSGEIRANCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2) and 25 ESTs. Cultivar="B73". Possible sequence variation in the following regionGGCgccGGGgggGGCGCC (two ESTs lack gccGGG and two contain it)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCGACCTTGCTACTGGCGAGACTGGCCGTGGCGTGCGCGCTGGCGCTCGGCGCCATGGCGCAGCTGTCGCCGACGTTCTACGACGCGAGCTGCCCCAGCCTGCAGGCCATC
GTGCGGGCCGGGATGGCCGCCGCCGTGCAGCAGGAGCCGCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GTAAGCATGCATGTCGTGGCGCCTTGGGCT
TGCTGCTGGTCGTCAGTATGCGTCGCGCCGCGCCATCCATCCAACACTCCATTATTATTATTATTATTGCCCATGCAGGGGTGCGACGCGTCCGTGCTCCTCGACGACTCGCCGACGCTG
ACGGGGGAGAAGAACGCGGGGCCCAACGCCAACTCCCTGCGCGGCTTCGAGGTCATCGACTCCATCAAGTCCCAGGTGGAGGCCGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTC
GCCCTCGCCGCGCGCGACGGCGTCAACCTG
GTCAGTGAGCCATGCATCCTTATCCTTTGTTTGCCTGGTATCGATCATCGCACGGTCGCCCCGACCACTGCTGGCTGGCTGGCGCTACCA
GTACAGAGTACTACACCACCTGCCGACACCCCGTGCTGATTGCTGCCACGATGCATGCATGTCCATCCATCAGTCATCAGTAAAAAAAAGAAAGGAAGAAAAAAAAAGCATAGCCATACC
CATGCATTGCATGCAACTCGGCTGGATCGGTCCCGTCAAACAAGCTGGTCAGCAACGTGCGGGCCAGCAAGCCTTCACCAACCGTTCTGTCGTCAAACGCTCGCTCGCTCAGCAGTCGTG
CATGTGGCTACTGTACGTCGGTAGCTGTTCCGTTTGTCAGTCACCACATATACTCACAGTCACAGTAACAAGTAACACTCGAGATCGACGACAAAGCAGTTGTTTACATTTGGATTTGGT
TGCAGTGTAACGTAGGACAGTAGCATTTCACTGACACGATGTATGACAAACACTGCACTGCAATATTAATTAATGCAGCTGAGCGGTCCGACGTGGGCGGTGCAGCTGGGTCGCCGGGAC
ACGCGCACGGCGAGCCAGTCGGCGGCGAACAGCAACCTGCCGTCGCCGTCGTCGAGCGCGGCGGCGCTGGTGTCGGCGTTCGCGTCCAAGGGGCTGGACTCGCGGGACCTGGTGGCGCTG
TCGGGCGCGCACACGATCGGCGCGGCGCGGTGCGCCACCTTCCGTTCCCGCGTGTACAACGACACCAACATCAGCGCCGGGTTCGCGGCGAAGCGGAGGCAGATCTGCCAGGCGCAGGCC
GGGGCCAGCGACGGCAACCTGGCGCCGCTGGACGCCATGAGCTCCGTCAGGTTCGACAACGGCTACTTCCGCAACCTCGTGGCCCAGTTCGGCCTGCTCCACTCCGACCAGGAGCTCTTC
GGCGCCGGGGGGGGCGCCGTCGACTTCATCACGGCGCAGTACGCGCGCAACGGCGCCGCCTTCTCGCGGGACTTCGTCACGGCCGTCCTCAAGATGGGCAGCATCGGCCCGCTCACCGGC
TCCAGCGGCGAGATCCGCGCCAACTGCCGGAAGCCCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCGACCTTGCTACTGGCGAGACTGGCCGTGGCGTGCGCGCTGGCGCTCGGCGCCATGGCGCAGCTGTCGCCGACGTTCTACGACGCGAGCTGCCCCAGCCTGCAGGCCATC
GTGCGGGCCGGGATGGCCGCCGCCGTGCAGCAGGAGCCGCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GGGTGCGACGCGTCCGTGCTCCTCGACGAC
TCGCCGACGCTGACGGGGGAGAAGAACGCGGGGCCCAACGCCAACTCCCTGCGCGGCTTCGAGGTCATCGACTCCATCAAGTCCCAGGTGGAGGCCGCCTGCCCCGGCACCGTCTCCTGC
GCCGACATCCTCGCCCTCGCCGCGCGCGACGGCGTCAACCTG
CTGAGCGGTCCGACGTGGGCGGTGCAGCTGGGTCGCCGGGACACGCGCACGGCGAGCCAGTCGGCGGCGAACAGCAAC
CTGCCGTCGCCGTCGTCGAGCGCGGCGGCGCTGGTGTCGGCGTTCGCGTCCAAGGGGCTGGACTCGCGGGACCTGGTGGCGCTGTCGGGCGCGCACACGATCGGCGCGGCGCGGTGCGCC
ACCTTCCGTTCCCGCGTGTACAACGACACCAACATCAGCGCCGGGTTCGCGGCGAAGCGGAGGCAGATCTGCCAGGCGCAGGCCGGGGCCAGCGACGGCAACCTGGCGCCGCTGGACGCC
ATGAGCTCCGTCAGGTTCGACAACGGCTACTTCCGCAACCTCGTGGCCCAGTTCGGCCTGCTCCACTCCGACCAGGAGCTCTTCGGCGCCGGGGGGGGCGCCGTCGACTTCATCACGGCG
CAGTACGCGCGCAACGGCGCCGCCTTCTCGCGGGACTTCGTCACGGCCGTCCTCAAGATGGGCAGCATCGGCCCGCTCACCGGCTCCAGCGGCGAGATCCGCGCCAACTGCCGGAAGCCC
AACTAG

Retrieve as FASTA