Entry information : EgrPrx177(Eucgr.L02460 / Egrandis_v1_0.018912m)
Entry ID 8012
Creation 2011-02-09 (Qiang Li)
Last sequence changes 2011-03-01 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-01-28 (Christophe Dunand)
Peroxidase information: EgrPrx177(Eucgr.L02460 / Egrandis_v1_0.018912m)
Name EgrPrx177(Eucgr.L02460 / Egrandis_v1_0.018912m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx177
start..stop
S start..stop
EcamPrx177 667 0 1..332 1..332
EgrPrx140 662 0 1..332 1..332
EglPrx178 662 0 1..332 1..332
EgrPrx178 662 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4213..4620 408 N° 2 4807..4969 163 N° 3 5879..6306 428  
join(4213..4620,4807..4969,5879..6306)


exon

Literature and cross-references EgrPrx177(Eucgr.L02460 / Egrandis_v1_0.018912m)
DNA ref. Phytozome 12:   scaffold_940 (4213..6306)
EST ref. GenBank:   HS064661.1 [3' end]   HS065176.1 [3' end]
Cluster/Prediction ref. Genebank:   104430693
Protein sequence: EgrPrx177(Eucgr.L02460 / Egrandis_v1_0.018912m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   35475.81 (32325.1)  
PI (pH):   %s   8.32 (7.99) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRFFPNKAALFMMLLTVCIAPTLVKGQGTRVGFYSSSCPRAEAIIRSTVQAHFKSDPTVAPGLLRMHFHDCFVQGCDGSILIDGPNAEKTAGPNRLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAVPTGRRDGRVSLASDTANLPGFRDSVDVQKQKFADLGLNTLDLVALVGGHTIGTGACQFFSYRLYNFTNTTSSGADASIDPSFVSQLQSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSGKGSTQLDFNTEFAKSMVKMSKIGVKTGTDGEIRKICSAINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Alternative transcript corresponding to the fusion of the two loci: Egrandis_v1_0.018924m, Egrandis_v1_0.021795m, Egrandis_v1_0.020651m. Tandem duplication EgrPrx179 (identical)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGATTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACAGTATGCATTGCACCAACCTTGGTAAAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGCTGAGAAAACGGCCGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCGTGCTTCCATTTATAACAGATCTCCGATATGAGTGCAAACCAATGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACATGATTGATATCTTTTAATTGCAATGATTCTTCAAATATTTGAGATATCTTGAGTGATGGGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCGTCCCGACGGGACGTAGAGATGGGCGAGTCTCCTTGGCATCAGATACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGCAAAAGTTTGCTGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GTCAGTATTTTCAATTTGTCCCCATTTCAATTTACTATCCTGCAGTACACAAGTTGGCAACCAAATGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCTGTCTGCTGTATCTAAGGACAACTCCGCCTGTCGGTAGTTGTTATGGGCATGCATGGTAACATTTTTATTTTTTTCGATTTCTATTCTTTTGTTCT
CCGAAATAAAAAAAGAACAGAAATCTGTTTGGTAACACCAACTTATTTTTCTATTCACCGGAATAGAAAAATAACTAGGGAATAGATTTTAAACAGAAACAAGAAAAAAAAAAGTAGCTT
ATTGTTGTCGGGAACAATTTCTAAAAATAAGTTTTTCTTTTTCTATATTTCTTTTCTTCTTCTTCCTTGTTGCGGCCACTGCTGACCACCTGCCATCCATTGGCCACCGACTATGGCCGC
TGGCCTGCCGCCAGCGGCCATAGTCGGTGGCCAACCGCTGGTGACGATTGCCGTCGCCTGTAGTCCACCAACCGCCGCCCACAGCCCATCGGCCGACGGCCACCACCATCCGCCAACAAC
CTACTGTCAACAACTGCCGCACAATCGTCGCCTGCCGTCGCACGACTGCCGATAGTTGCTGCCGATCGCTGTCATAGGACTGCCACCCACAGCTCACCGACCATCGCCCCCTCTCGTGGC
TAGTGGGTTGTGGGCGGCAATCCTGTGTCAGTGGCGACGATTGGCGATCGTGCGCCGGTCGTGCGGTGGTCGTGCGGCGTTTGTGCGACAATCGTGCGACGGTCGTGCGGCGATCGTGCG
GCGGTCGTGCGGCGACAATCGTCGTAGATAATAAATTTCTCATATGTCCATGTGCATCAAAAGGGGTACACTAAGTTTCTTTGCTTTTGACCAATACTTGATACAGGAGGGCACACCATA
GGAACTGGAGCTTGCCAATTCTTCAGCTACAGACTCTACAACTTCACCAATACTACGTCAAGTGGAGCGGACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCG
CAAAACGGTGATGGCACAAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTCGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAAAAGCTA
TGGACCGATGCCTCCACCAAAACCTTCGTGCAAGGCTTTCTAAGTGGCAAAGGCTCGACCCAATTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTG
AAGACGGGGACCGATGGTGAAATTAGGAAAATATGCTCCGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGATTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACAGTATGCATTGCACCAACCTTGGTAAAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGCTGAGAAAACGGCCGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCGTCCCGACGGGACGTAGAGATGGGCGAGTCTCCTTGGCATCAGATACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGCAAAAGTTTGCTGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAATTCTTCAGCTACAGACTCTACAACTTCACCAATACTACGTCAAGTGGAGCGGACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCGCAAAACGGTGATGGC
ACAAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTCGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAAAAGCTATGGACCGATGCCTCC
ACCAAAACCTTCGTGCAAGGCTTTCTAAGTGGCAAAGGCTCGACCCAATTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTGAAGACGGGGACCGAT
GGTGAAATTAGGAAAATATGCTCCGCCATTAATGCATGA

Retrieve as FASTA