Entry information : EgrPrx138 (Eucgr.I02673 / Egrandis_v1_0.018939m)
Entry ID 8013
Creation 2011-02-09 (Qiang Li)
Last sequence changes 2011-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx138 (Eucgr.I02673 / Egrandis_v1_0.018939m)
Name (synonym) EgrPrx138 (Eucgr.I02673 / Egrandis_v1_0.018939m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx138
start..stop
S start..stop
EglPrx178 670 0 1..332 1..332
EgrPrx178 670 0 1..332 1..332
EguPrx138 664 0 1..332 1..332
EgrPrx140 664 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37896586..37896993 408 N° 2 37897180..37897342 163 N° 3 37897764..37898191 428  
join(37896586..37896993,37897180..37897342,37897764..37898191)


exon

Literature and cross-references EgrPrx138 (Eucgr.I02673 / Egrandis_v1_0.018939m)
DNA ref. Phytozome 12:   scaffold_9 (37896586..37898191)
Protein sequence: EgrPrx138 (Eucgr.I02673 / Egrandis_v1_0.018939m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   35549.91 (32399.3)  
PI (pH):   %s   8.65 (8.58) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRFFPNKAALFMMLLTVCIAPTLVQGQGTRVGFYSSSCPRAEAIIRSTVQAHFKSNPTVAPGLLRMHFHDCFVQGCDGSILIDGPNVEKTAGPNRLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAVPTGRRDGRVSLASDTANLPGFRDSVDVQKKKFADLGLNTLDLVALVGGHTIGTGACQLFSYRLYNFTNTTSSGADASIDPSFVSQLRSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSSQGPTRLDFNTEFAKSMVKMSNIGVKTGTNGEIRKICSAINA*

Retrieve as FASTA  
Remarks Coplete sequence from genomic. Also found in scaffold_940 with various transcripts at this locus: Egrandis_v1_0.018924m, Egrandis_v1_0.020652m, Egrandis_v1_0.021795m, Egrandis_v1_0.021791m, Egrandis_v1_0.018912m (primary), Egrandis_v1_0.020651m. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTAATCCCACTGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGTTGAGAAAACGGCAGGTCCAAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCGTGCTTCCATTTATTAGAGATCTCCGATATGAGTGCAAACCAATGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACATGATTGATATCTTTTAATTGCAATGATTCTTCAAATATTTGAGATATCTTGAGTGATGTGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GTCAGTATTTTCAATTTGTCGCCATTTCAATTTACTATCCTGCAGTACAGAAGTTGGCAACCGAACGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCCGTCTGCTGAATCTAAGGACAACTCCGCCCGTCGGTAGTTGTTATATTTCTTCTTGTCCTGTTGTTAAGGACGACTGTGGCTGTCCCTAAAATCTG
ATTAATCTTCTTTCTAATTTCCTTTAAGAGCTGTAAACATGAAGTTTATTTGTAAACATGAAGTTTATTTGTCATAGGTAAGATAGAATAGACATATTAAAAACTTGTCGACTTATTGCT
TCTTGCTATCTCGTAATTAAATCGAGTCTTCCCATATGTCCATGCGCATCAAAAGGGATACACTGAGTTTCTTCGCTTTTGACCAATACGCGATACAGGAGGGCACACCATAGGAACTGG
AGCTTGCCAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGG
TGATGGCACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGA
TGCCTCCACCAAAACCTTCGTGCAGGGCTTTCTAAGCAGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGG
GACCAATGGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTAATCCCACTGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGTTGAGAAAACGGCAGGTCCAAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGC
ACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGATGCCTCC
ACCAAAACCTTCGTGCAGGGCTTTCTAAGCAGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGGGACCAAT
GGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA