Entry information : EgrPrx94 (Eucgr.F03670 / Egrandis_v1_0.048497m)
Entry ID 8019
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx94 (Eucgr.F03670 / Egrandis_v1_0.048497m)
Name (synonym) EgrPrx94 (Eucgr.F03670 / Egrandis_v1_0.048497m)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx94
start..stop
S start..stop
EglPrx94 677 0 1..326 1..326
EcamPrx94 662 0 1..326 1..330
EguPrx94 657 0 1..326 1..326
GmPrx64 459 4e-164 33..326 48..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45039593..45039826 234 N° 2 45038707..45039049 343 N° 3 45038034..45038437 404  
complement(join(45038034..45038437,45038707..45039049,45039593..45039826))


exon

Literature and cross-references EgrPrx94 (Eucgr.F03670 / Egrandis_v1_0.048497m)
DNA ref. Phytozome 12:   scaffold_6 (45039826..45038034)
Protein sequence: EgrPrx94 (Eucgr.F03670 / Egrandis_v1_0.048497m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   36035.37 (33435.9)  
PI (pH):   %s   9.23 (8.82) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAFVPSALFLVALHLISATVRAGGLPVEAYGLSFQYYQESCPNFEAIVSRKVKEWIKKDYTLAPALMRLHFHDCVVRGCDASILLNYPGSERSAAESKTLRGFEVINDIKVALEKSCPKMASCADILTSAARDATVLAGGPFWMVPYGRKDGRVSVAKEASKVPVGHENVTSLLQLFQSQGLNVLDLVVLSGAHTIGRSTCGSIQSRLYNYKSTGKPDPTLNREYGNYLKRKCRWASEYVYLDGRTPKTFDNMYYKNLQKKMGLLSTDQYLNSDSRTGPLVSALATQPELFNYQFGVSMAKLGNVQVLTGDEGEVRTNCNAVNRY*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGCCGTCGGCGCTGTTTCTCGTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAAAGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GTACGT
AGTTTGTCCGACCGCTTTTTTTTTTTTTCTTTTTTTTTTAAATGAAAAAGGGCTAAAGCAGATTAAAAAAAGTTAACGTGGTAAATATACTATTTCTATTTTATCACCTGATAATAATAA
ATAAAAAAATTAGTATTCCAGCACTTGTCAATTCCAAAGTTAGCAATCTAGTCAGCAGAGCAATTTCCTTATCCAAAATTATGTTGGTCAGCATCAACCAAATTATTTTCGTAAGTTTTG
CAAAAATCGCACTTATTAATAAAGTCGTCGCTAAGAAAAGCAACCAAAAATTTATTATCTAGTAGTGGCCACATATAAAAATGACATACATAAGGCAATTTCAAAATCATAATGAGAAGT
CTTTATAGTTAATGAATCAATACACTAACATTAATTAACTTATTGCATTATAATTTATATCTCACTCTTGATTGAGCTTTCTATAGACCAAATCAAAAAATTTCGACATCCAAGTAAACC
AAAATGAGAATTTTTGCCGGCTTCATTTGACTCGAGTTTCTTGATTTGGTTATGTAGGGATGCGACGCGTCGATACTATTGAACTACCCAGGGAGCGAGAGGAGCGCCGCAGAGAGCAAG
ACTCTCAGGGGGTTCGAGGTGATCAACGACATAAAGGTAGCGCTTGAGAAGAGCTGCCCGAAGATGGCATCGTGCGCTGACATCCTGACCTCGGCCGCGAGGGACGCCACCGTGTTGGCC
GGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAGGCCAGCAAGGTGCCGGTTGGCCACGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAA
TCCCAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GTGAACTTTTTCTCATTTCTTTTCACAAATCAACGAAAAAATAAATAAATAAAAAAATAAAGTCTAAAACACTATATTCC
ATTTTTAATTTATTTATTATCTATATAGCAATTTTAGTCTATAGGGTGCTTTTTGAATGGATGTGAGGATTAGTTTATGAAATTTTTATGGTCAACTTTGATTAAAAAAAATCACCATGT
ATTCTCAAATATAATTGAAATGTACATTTTTAATTTTATTCTTTTTCCTTCTTCTTGATCCGGGTGCAGGCGCGCACACGATAGGGCGAAGCACCTGCGGGTCCATCCAATCGCGGCTCT
ACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTACGTGTACCTCGACGGGAGGACCCCGAAAA
CCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCGCTCGTGTCGGCGCTCGCCACCCAGCCCG
AGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGCAACGCCGTCAACCGCTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGCCGTCGGCGCTGTTTCTCGTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAAAGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GGATGC
GACGCGTCGATACTATTGAACTACCCAGGGAGCGAGAGGAGCGCCGCAGAGAGCAAGACTCTCAGGGGGTTCGAGGTGATCAACGACATAAAGGTAGCGCTTGAGAAGAGCTGCCCGAAG
ATGGCATCGTGCGCTGACATCCTGACCTCGGCCGCGAGGGACGCCACCGTGTTGGCCGGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAG
GCCAGCAAGGTGCCGGTTGGCCACGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAATCCCAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GCGCGCACACGATAGGGCGAAGC
ACCTGCGGGTCCATCCAATCGCGGCTCTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTAC
GTGTACCTCGACGGGAGGACCCCGAAAACCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCG
CTCGTGTCGGCGCTCGCCACCCAGCCCGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGC
AACGCCGTCAACCGCTACTGA

Retrieve as FASTA