Entry information : SbPrx54 (Sobic.003G121100.1 [2.1] / SB03G010250 [1.4])
Entry ID 802
Creation 2006-01-02 (Christophe Dunand)
Last sequence changes 2006-01-02 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx54 (Sobic.003G121100.1 [2.1] / SB03G010250 [1.4])
Name (synonym) SbPrx54 (Sobic.003G121100.1 [2.1] / SB03G010250 [1.4])
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx54
start..stop
S start..stop
SiPrx17 662 0 1..334 1..334
SofPrx04 651 0 1..334 1..334
ZmPrx18 648 0 1..334 1..333
OsPrx03 624 0 5..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11115525..11115752 228 N° 2 11116415..11116606 192 N° 3 11116716..11116881 166 N° 4 11116985..11117403 419
join(11115525..11115752,11116415..11116606,11116716..11116881,11116985..11117403 )


exon

Literature and cross-references SbPrx54 (Sobic.003G121100.1 [2.1] / SB03G010250 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (11115525..11117403)
Protein sequence: SbPrx54 (Sobic.003G121100.1 [2.1] / SB03G010250 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (309)
PWM (Da):   %s   35663.02 (33128.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.32 (8.39) Peptide Signal:   %s   cut: 26 range:26-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTSMGSLVLLCLVSTLLFPSAVLGHPWGGLFPQFYDHSCPKAKEIVQSIVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSLRGFEVVDQIKAALEAACPGTVSCADILALAARDSTSLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVVDVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAAQLRQGCPRSGGDNNLFPLDFVTPAKFDNFYYKNLLAGKGLLSSDEVLLTKSAETAALVKAYAADVNLFFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNSH

Retrieve as FASTA  
Remarks Complete sequence from 22 ESTs and genomic (chromo 3, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACTTCCATGGGTTCTCTCGTCTTGCTCTGCCTTGTTTCTACCCTCCTCTTTCCCAGTGCCGTCCTTGGCCACCCATGGGGTGGCTTGTTCCCACAGTTCTATGACCATTCGTGC
CCCAAGGCGAAGGAGATTGTGCAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCAGCATCCTTGGTCAGATTGCATTTCCATGACTGCTTTGTCAAG
GTAAACTCTGCT
TCCTCTGTTATGTTCTTTATTACATGCTCTGACACAGCTATGATGCTTGATACTGCAGTACAATATAACAAGTTAGCGATACAAGTTTTGTACTTCAAGTCTTTTAACTATATGTTGGTA
CAATAAGATTCTGAGTAATCCATATAAAGGTGTTGCAAACAAACATGAAAAGCAAAGATAAATGGATGAATTCATTACTAGCTTTGGCTGTTTAAAACCAATAACTTGATTGCGCTTGTG
CTACATGCGTGCCTAAATATTAGAAAAGGTAGCATGAGAGAATCTATATTATTTTGGCTAACTTCTTCAAATTACTATTGATTGATGAGAAAGCCTACCATTGCCCATGCCAGCACTACT
TTATGTCCTGGTGACATGATCGAGCCAGTACTATGATTGATTAACTCTATTGTTCTCCTTTTTTGAGTGCTATATAAGATGTCCTTTTTCTTTGTGAGCCACACGAGAAGATGTTTACTT
AACTCTAGTGCACAATGATTGAAGCTCCCTGTGTAACGTTTGTCATCTCTTATTCAATGCATGTGCCCGATGAATCTACTGTCACCACTACTATGTAGCATGTACCTAATCTCTAAACTA
CTCCATGTGGCTAGTAATTACCATCTTTTACAACATTGTTACATGTGTAGGGCTGCGATGCTTCAGTGCTGTTGGACAACAGCAGCAGCATAGTTAGTGAGAAAGGGTCCAATCCGAACA
GGAACTCCCTCAGGGGGTTTGAGGTGGTCGACCAGATTAAGGCTGCTCTCGAGGCTGCCTGCCCAGGCACTGTCTCCTGTGCAGACATTCTTGCCCTCGCGGCTCGTGATTCCACTTCCC
TG
GTACATTCCACTATCAACAACCCTGTCCAACCTTAAGGAAGAGACATGATATTTGTATATATAGTGATAGCTTTGGCAAAGTTAGATTTTTCTGAACTCTAATCTGTAGGTTGGTGGC
CCATACTGGGATGTGCCACTTGGCCGGAGGGACTCGCTCGGCGCAAGCATCCAGGGCTCCAACAATGACATCCCAGCCCCCAATAACACACTCCCCACTATCATCACCAAGTTCAAGCGC
CAGGGCCTCAATGTTGTTGATGTTGTTGCCCTCTCAG
GTGACTTTTAGTGTATTTCTTAGTATCATCTGTCCATCGTATTGACCAACTTAACGTACACTCATATTACACAACATGGATAC
AATATCATGTGCGAATACAGGTGGTCACACCATAGGTATGTCTCGGTGCACTAGCTTCCGGCAGAGGCTGTACAACCAGACAGGCAATGGCATGGCTGACAGCACGCTGGATGTATCTTA
CGCCGCGCAGCTGAGGCAGGGGTGCCCCCGCTCTGGTGGTGACAACAACCTCTTCCCCTTGGACTTCGTCACCCCAGCCAAGTTTGACAATTTTTACTACAAGAACCTCCTGGCCGGCAA
GGGCCTTCTAAGCTCTGATGAGGTTCTGTTAACCAAGAGCGCTGAGACAGCGGCCCTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTATGGTGAA
TATGGGCAACATCTCGCCACTGACAGGGTCACAAGGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAACAGCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACTTCCATGGGTTCTCTCGTCTTGCTCTGCCTTGTTTCTACCCTCCTCTTTCCCAGTGCCGTCCTTGGCCACCCATGGGGTGGCTTGTTCCCACAGTTCTATGACCATTCGTGC
CCCAAGGCGAAGGAGATTGTGCAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCAGCATCCTTGGTCAGATTGCATTTCCATGACTGCTTTGTCAAG
GGCTGCGATGCT
TCAGTGCTGTTGGACAACAGCAGCAGCATAGTTAGTGAGAAAGGGTCCAATCCGAACAGGAACTCCCTCAGGGGGTTTGAGGTGGTCGACCAGATTAAGGCTGCTCTCGAGGCTGCCTGC
CCAGGCACTGTCTCCTGTGCAGACATTCTTGCCCTCGCGGCTCGTGATTCCACTTCCCTG
GTTGGTGGCCCATACTGGGATGTGCCACTTGGCCGGAGGGACTCGCTCGGCGCAAGCATC
CAGGGCTCCAACAATGACATCCCAGCCCCCAATAACACACTCCCCACTATCATCACCAAGTTCAAGCGCCAGGGCCTCAATGTTGTTGATGTTGTTGCCCTCTCAG
GTGGTCACACCATA
GGTATGTCTCGGTGCACTAGCTTCCGGCAGAGGCTGTACAACCAGACAGGCAATGGCATGGCTGACAGCACGCTGGATGTATCTTACGCCGCGCAGCTGAGGCAGGGGTGCCCCCGCTCT
GGTGGTGACAACAACCTCTTCCCCTTGGACTTCGTCACCCCAGCCAAGTTTGACAATTTTTACTACAAGAACCTCCTGGCCGGCAAGGGCCTTCTAAGCTCTGATGAGGTTCTGTTAACC
AAGAGCGCTGAGACAGCGGCCCTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTATGGTGAATATGGGCAACATCTCGCCACTGACAGGGTCACAA
GGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAACAGCCACTGA

Retrieve as FASTA