Entry information : EgrAPx07
Entry ID 8024
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Bruno Savelli
Last annotation changes 2014-01-14 (Bruno Savelli)
Peroxidase information: EgrAPx07
Name EgrAPx07
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx07
start..stop
S start..stop
EglAPx07 711 0 1..356 1..356
EguAPx07 710 0 1..356 1..356
EcamAPx07 575 0 63..356 20..313
VvAPx07 557 0 2..356 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4943903..4944025 123 N° 2 4943656..4943754 99 N° 3 4943367..4943451 85 N° 4 4943238..4943272 35
N° 5 4943044..4943109 66 N° 6 4942898..4942938 41 N° 7 4942325..4942455 131 N° 8 4942035..4942141 107
N° 9 4941350..4941487 138 N° 10 4940698..4940832 135 N° 11 4940352..4940462 111  
complement(join(4940352..4940462,4940698..4940832,4941350..4941487,4942035..4942 141,4942325..4942455,4942898..4942938,4943044..4943109,4943238..4943272,4943367. .4943451,4943656..4943754,4943903..4944025))


exon

Literature and cross-references EgrAPx07
DNA ref. Phytozome 11:   scaffold_6 (4944025..4940352)
Protein sequence: EgrAPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357
PWM (Da):   %s   38340.49  
PI (pH):   %s   6.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMGASFVSTVPSLLPLQAQVAPPSSSTSSSAAPVRPPAARPVAVRCKTENGFADGGEELSRRDVLKLVGASVGIELMASSGSFVESARAADLIQRRQRSEFLSNVRGTLFTAIGNPDLIPSLLMLALNDAMTYDKASKSGGPNGSIRFSSEISRPENKGLSAAMNLLEEAKKEIDSYSKGGPMSYADLIQYAQSALKATFLASAIRKCGGNEEKGGLLYTAYGSSGQWGLFDKQFGRSDTTEPDPEGRVPQWEKASVKEMKDKFSAIGFGPRLAVMSLFLGPDQTATETLLAADPDVSPWVQKYQRSRETVSETDYEVDLITTLTKLSSLGQQINYEAYTYPVPRVDFSKLKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome. Three other alternative transcripts predicetd from Phytozome: Egrandis_v1_0.017819m, Egrandis_v1_0.018242m, Egrandis_v1_0.018783m.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2

ATGATGGGCG CGTCCTTCGT CTCCACCGTC CCTTCTCTG 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2

ATGATGGGCG CGTCCTTCGT CTCCACCGTC CCTTCTCTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGCGCGTCCTTCGTCTCCACCGTCCCTTCTCTGCTCCCGCTTCAAGCTCAAGTCGCTCCTCCTTCTTCTTCCACCTCGTCTTCCGCCGCCCCCGTCAGGCCCCCCGCCGCTCGT
CCC
GTTAGTCTTCCTCCTCGCTTCCGCTTTTTTTGCTTCGAAATCCGGCATTGTGAATTGCTCTCGTCGGTGTCCGCGCTCGACGCTGCGTAGTTGAGCCTCCTGATCGGTGTGTAATGC
TTGTCGTCTTCTCCGGTCGTCGAAAGTTCAGGTTGCGGTTCGCTGCAAGACGGAGAACGGCTTCGCCGATGGCGGCGAGGAGTTGAGCCGACGAGACGTTCTTAAACTCGTCGGCGCTAG
CGTCGGCATT
GTAAGTGCGATTCCTCCCGTTGTTTAGCCGTTACGTCAGCTACATTGAGCTCCGTGAATGTGATCTTCCGTATGTTTTATCTGTCTGCTCGGTCGCGATTAAGATTTCGT
TCTGGTTCGCCGTTTGACCTTTGGCTTTGTGGAAATGACGGTCCGTTCTTTTAGCGTGGATGTTGATGAGTTTCTGCCAGCTGTGATCTCGCAGGAACTGATGGCGAGCTCTGGATCATT
CGTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCCGAGTTTCTTT
GTAAGCCCCCGCTGAAGAGTCGCTTCTTTTTCTATTGCTAGTGCATTGAAATATGAATCTC
CAGAATCAAATTGACTTCCTTCTGTGTCCTCAGCAAATGTCAGGGGCACCCTTTTCACGGCTATAAAGGTGAATTTTTGTTATGCTTTGGCATTTAGGCATATGATTTTGGCTCTCGTGA
TTTTGTTACACATATCCTAAAATGCTATACTTTGATATAAATTTATTAATTGATTTCTCTCTTGGACTCATTTCAGGGAAATCCAGATCTCATCCCATCTTTACTGATGTTGGCATTAAA
TGATGCTATGACTTATGACAAG
GTCACACTTAGATTTTGCATGTTGAAATTTAATGGGAATAGTTCATCTCACTAAGTATGATTAGGTAATGATTGAGTTATGATTTATTTTCCCTCAAG
CTTGCAGGCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGGTACTTGTCACATTAAAACATGTGAATGCTGATGTGAGTTGATGATCATAGCGCAGAGCAGTATTTTCAATT
TGTTGGGTTTAGTGAGCCCCCTAATTTCGATTTTCTGAGGGTTGAACTCTTCACACAACCGGCTCCCTCTCAGAATGATAATCTAGCGAGGTCTTTGTTTCACACAACCGGCTCCCTCTT
ATATGCAGTTCTATATTACTAATTCAATCTTATCCAGAAATCTCCATTTAGAGAATCAAGAAGCTGAGCATCTAGAGTTAATTGAGGAAAATAGAAAGAGAAAACTTGATTGCCCCGCAG
GATGGTTCCCATGTTTCAAGTTCTCATGTGTATCTTCCAGTTTAAAATTTCATGCTTTTGCCGCACATCTGTTATCTCCTAGATGAGACTCACCATGATTTCCAATGTCATGAACTGTTA
TTTCTTGAAGCTCAGAGATTAGCAGACCTGAGAATAAGGGCCTTTCAGCTGCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATGTCCTATG
CAGATCTTATACAGTATGCAG
GTTTGTACATGTTACATAGCTAAGTTGCATGTCCCTAGCATAAAATGCTGCTCTTGGTCTGGACTTCTGTTAGTACCTTCTAGAATAACCCCCAAAAGA
AGAAGTATTCACTAGAGCCATTAGGCTTGGGGATCTGGCTTTGAATATCTTATGCCATGTATTGAAAGTTCTGCCTCTGAACAGCGCAGAGTGCACTCAAGGCTACCTTTCTAGCTTCAG
CCATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGGGCCTGCTCTACACTGCCTATGGTTCCAGCGGACAG
GTAATTCCTAATTCGTTGTGTGCATGGAATCTTATGCGTTTGCCACCAG
ATTTTATAGTGTAAAATCAACAACGAAATAGGAATAAAATTTCCTACAACTAGTAATTTAGTATTCATAATGTGTTACCGTCAGGACTTTTAGTCAGTGTATCTTGGGAGGTGAACTAGT
TTAGGTATAGGTATAGATAAGTCTAAAATTTACTTGCAGCCAGTAGTTTCTCGGGGAATATTCAAAAAATGGTTTCATGCTAAACAACAGATGAAGGATTTGTTTCAGAACGTATTCCTT
CATCTGACGATTGCCATAAAATACCGTGTTTATTGACCATTTGTTGTTGCTCACTATTGCTATGTTCATTCAATAGCTTGATTCTTGAATACATGTTCGGAAAAAAAAATGATCCCTATA
GTTTACCAATTTTTCCTTTGAATATATTGGAAATAAACCTATGAATAACATAACAACTGCCTTGACATATTGTTTCTCAAATAATTCTCATAGTTTTAGTTCTGATTTTCATATTACATA
AATCGTCCCGTCATGCAGTGGGGCTTGTTTGACAAACAATTTGGGAGGTCAGACACCACGGAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAA
GATAAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
GTATATTCAGTAGAACATTTACTGCTTATGCAGGAATACTCTGAACTTCCATACATATTGTCCTCTTTATGCACCAAGAATTTC
ATCTACAAAATTGCAATGGGAAAACAAGGTTATCTTTTCACCATTTCCAGAAACCAAGAGACATGCGGCTGAACAAGCAGTCTCATGATGTGCACTGCATTCAGATATATTTGATGATTC
ATTTCTCTATTATGTTAATCTTCTCTGAATTAGCTAGATTCTTTTCTTAAATTTCCATACCATATATTTTTTTTTTGGTAAGGTATTTCCATACCATATATTGTTTTCTGCATCTTTATA
TTTTTGGAAATTTTTTCAAAGCTCAAAATTGGAGAATTGAATGTGGTTTTCTGTTAAATGATCTCTATTTGCAGATTGGTCTTGTAATGAGATTTAAACATTCTCAGCGTTGCTTCCCGT
CAATCTCGAAAACTGGTAGTCAATGATGGACTGCATAGGAACTAAATCTGCTTTTAACTTCTTGACTGAACAGCTAGCAGTGATGTCTTTGTTTCTGGGTCCTGATCAGACAGCAACAGA
GACATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTTGGTTATACAAAGTTGCTCTTTTCAGAATG
TGAAAGCCTTACTTGATATTTGCCATCATGGTGGTGAAGAATAACCGAAGAAAAACAATATTATGGCCTTCTGTGCCCCAAAAAAAAACAGAATCTCTGAATCGTAATCGATTTGTTGGC
CAAAAAGAATAGTTAATGTAAGCGTCTTAGAATCGTTGCGTTCGCTTCACTCGGACATTGATCTTAATCCCGTCTTTTTACAGGTCGATTTGATAACTACTCTGACCAAATTAAGCAGCT
TGGGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCAAGGGTTGATTTCAGCAAGCTCAAATTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGCGCGTCCTTCGTCTCCACCGTCCCTTCTCTGCTCCCGCTTCAAGCTCAAGTCGCTCCTCCTTCTTCTTCCACCTCGTCTTCCGCCGCCCCCGTCAGGCCCCCCGCCGCTCGT
CCC
GTTGCGGTTCGCTGCAAGACGGAGAACGGCTTCGCCGATGGCGGCGAGGAGTTGAGCCGACGAGACGTTCTTAAACTCGTCGGCGCTAGCGTCGGCATTGAACTGATGGCGAGCTCT
GGATCATTCGTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCCGAGTTTCTTT
CAAATGTCAGGGGCACCCTTTTCACGGCTATAAAGGGAAATCCAGATCTCATC
CCATCTTTACTGATGTTGGCATTAAATGATGCTATGACTTATGACAAG
GCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGCTCAGAGATTAGCAGACCTGAGAATAAGGGC
CTTTCAGCTGCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATGTCCTATGCAGATCTTATACAGTATGCAG
CGCAGAGTGCACTCAAGGCT
ACCTTTCTAGCTTCAGCCATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGGGCCTGCTCTACACTGCCTATGGTTCCAGCGGACAG
TGGGGCTTGTTTGACAAACAATTTGGGAGGTCA
GACACCACGGAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAAGATAAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
CTAGCAGTGATGTCT
TTGTTTCTGGGTCCTGATCAGACAGCAACAGAGACATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTCGATTTGATAACTACTCTGACCAAATTAAGCAGCTTGGGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCAAGGGTTGATTTCAGCAAGCTCAAATTGTGA

Retrieve as FASTA