Entry information : EgrPrx178
Entry ID 8029
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-09 (Qiang Li)
Peroxidase information: EgrPrx178
Name EgrPrx178
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx178
start..stop
S start..stop
EglPrx178 680 0 1..332 1..332
EgrPrx138 670 0 1..332 1..332
EcamPrx178 665 0 1..332 1..332
EguPrx138 664 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11150..11557 408 N° 2 11744..11906 163 N° 3 12316..12743 428  
join(11150..11557,11744..11906,12316..12743)


exon

Literature and cross-references EgrPrx178
DNA ref. Phytozome 12:   scaffold_940 (11150..12743)
Protein sequence: EgrPrx178
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   35468.85 (32332.2)  
PI (pH):   %s   8.65 (8.40) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRFFPNKAALFMMLLSVCIAPTLVKGQGTRVGFYSSSCPRAEAIIRSTVQAHFKSDPTVAPGLLRMHFHDCFVQGCDGSILIDGSNAEKTAGPNRLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAVPTGRRDGRVSLASDTANLPGFRDSVDVQKKKFADLGLNTLDLVALVGGHTIGTGACQLFSYRLYNFTNTTSSGADASIDPSFVSQLRSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSGQGPTRLDFNTEFAKSMVKMSNIGVKTGTNGEIRKICSAINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTTCGGTATGCATTGCACCAACCTTGGTAAAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGTCCAACGCTGAGAAAACGGCCGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCATGCTTCCATTTATAACAGATCTCCGATATGAGTGCAAACCAATGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACACGATTGATATCTTTTAATTGCAATGATTCTTCAAATATTTGAGATACCTTGAGTGATGTGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GTCAGTATTTTCAGTTTGTCGCCATTTCAATTTACTATCCTGCAGTACAGAAGTTGGCAACCGAACGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCCGTCTGCTGAATCTAAGGACAACTCCGCCCGTCGGTAGTTGTTATATTTCTTCTTGTCCTGTTGTTAAGGACGACTGTGGCTGTCCCTAAAATCTG
ATTAATCTTCTTTCTAATTTCCTTTAAGAGCTGTAAACATGAAGTTTATTTGTCATAGGTAAGAGAGAATAGACATATTAAAAACTTGTCGACATATTAAAAACTTGTCGACTTATTGCT
TCTTGCTATCTCGTAATTAAATCGAGTCTTCTCATATCAAAAGGGATACACTGAGTTTCTTTGCTTTTGACCAATACGCGATACAGGAGGGCACACCATAGGAACTGGAGCTTGCCAGTT
ATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGCACGAG
GCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGATGCCTCCACCAA
AACCTTCGTGCAGGGCTTTCTAAGCGGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGGGACCAATGGTGA
AATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTCGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTTCGGTATGCATTGCACCAACCTTGGTAAAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGTCCAACGCTGAGAAAACGGCCGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCGTGCCGACGGGACGTAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTTGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGC
ACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCTGATCAGAAGCTATGGACGGATGCCTCC
ACCAAAACCTTCGTGCAGGGCTTTCTAAGCGGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGGGACCAAT
GGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA