Entry information : SbPrx91 (Sobic.006G079300.1 [2.1] / SB06G016610 [1.4])
Entry ID 803
Creation 2006-01-06 (Christophe Dunand)
Last sequence changes 2006-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx91 (Sobic.006G079300.1 [2.1] / SB06G016610 [1.4])
Name (synonym) SbPrx91 (Sobic.006G079300.1 [2.1] / SB06G016610 [1.4])
Class Class III peroxidase    [Orthogroup: Prx128]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Inducers Acid treatment
Alkaline treatment
Brassinolide treatment
Dark growth
Gibberellic acid treatment
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx91
start..stop
S start..stop
ZmPrx19 652 0 1..349 1..340
ZmPrx83 612 0 1..348 1..348
SiPrx12 611 0 1..348 1..344
OsPrx54 547 0 34..349 34..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45453960..45454427 468 N° 2 45454550..45455131 582  
join(45453960..45454427,45454550..45455131)


exon

Literature and cross-references SbPrx91 (Sobic.006G079300.1 [2.1] / SB06G016610 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_6 (45453960..45455131)
Protein sequence: SbPrx91 (Sobic.006G079300.1 [2.1] / SB06G016610 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (321)
PWM (Da):   %s   37432.83 (34668.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.01 (6.74) Peptide Signal:   %s   cut: 29 range:29-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRQLISGGLAVVAVVAVLSSVLICSAHPVPGGHGGGFPPALLLQPHFYDHACPQMQAIVGSIVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPHTVSCADIVAVAARDSVVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDSLPTIIVKFANQGLDVVDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDQATQFRFDNLYYHNILAMNGLLSSDEILLTQSRETMELVHRYAADQGLFFDHFAKSMVKMGNISPLTGTAGEIRHNCRRVNHF*

Retrieve as FASTA  
Remarks Complete sequence from 18 ESTs + CD212604 (3'end) and genomic (chromo 6, intron 2)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGCGACAGTTGATCAGCGGCGGCCTCGCGGTCGTCGCGGTGGTCGCCGTGCTGTCGTCGGTGCTGATCTGCTCGGCGCACCCGGTGCCGGGCGGACACGGTGGCGGGTTCCCG
CCGGCGCTGCTGCTGCAGCCGCACTTCTACGACCACGCGTGCCCGCAGATGCAGGCCATCGTGGGCTCCATCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTC
CGGATGCACTTCCACGACTGCTTCGTGCAGGGCTGCGACGCCTCCGTGCTGCTCGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAGCGCTCCAACCCCAACAAGGACTCCCTCCGC
GGCTTCGAGGTCATCGACGAGATCAAGGCCGCGCTGGAGCACGCCTGCCCGCACACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
GTACGATTTACA
AACTAATGCAGCGTCGTCGTTCAGTTCAGTATCGTCGTCTATCCACCGTTGTCGAGTTATTTACATTACTTACTCCGATGGTCGCCGCCGATCGAACTGCATGCATGCAGACCGGCGGAC
CTGGCTGGGAGGTGCCACTGGGGAGGAGGGACTCACTGACGGCGAGCCTGAGCGGCTCGAACAACCTCATCCCTGCGCCCAACGACTCGCTCCCCACCATCATCGTCAAGTTCGCCAACC
AGGGCCTCGACGTCGTCGACCTCGTGGCGCTCTCAGGAGGGCACACCATCGGCGACTCGCGGTGCGTGAGCTTCCGGCAGCGGCTGTACGGGCAGAACAACAACGGGCAGGTGGACCGGA
CGCTGAACCCGGCGTACGCGGCTGAGCTGCGGGGGCGGTGCCCGCGGTCCGGCGGCGACCAGAACCTGTTCGCGCTGGACCAGGCGACGCAGTTCCGGTTCGACAACCTGTACTACCACA
ACATCCTGGCCATGAACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGAGCCGCGAGACCATGGAGCTCGTCCACCGCTACGCCGCCGACCAGGGCCTCTTCTTCGACCACTTCG
CCAAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACCGGAACCGCCGGCGAGATCAGGCACAACTGCAGGAGGGTCAACCACTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGCGACAGTTGATCAGCGGCGGCCTCGCGGTCGTCGCGGTGGTCGCCGTGCTGTCGTCGGTGCTGATCTGCTCGGCGCACCCGGTGCCGGGCGGACACGGTGGCGGGTTCCCG
CCGGCGCTGCTGCTGCAGCCGCACTTCTACGACCACGCGTGCCCGCAGATGCAGGCCATCGTGGGCTCCATCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTC
CGGATGCACTTCCACGACTGCTTCGTGCAGGGCTGCGACGCCTCCGTGCTGCTCGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAGCGCTCCAACCCCAACAAGGACTCCCTCCGC
GGCTTCGAGGTCATCGACGAGATCAAGGCCGCGCTGGAGCACGCCTGCCCGCACACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
ACCGGCGGACCT
GGCTGGGAGGTGCCACTGGGGAGGAGGGACTCACTGACGGCGAGCCTGAGCGGCTCGAACAACCTCATCCCTGCGCCCAACGACTCGCTCCCCACCATCATCGTCAAGTTCGCCAACCAG
GGCCTCGACGTCGTCGACCTCGTGGCGCTCTCAGGAGGGCACACCATCGGCGACTCGCGGTGCGTGAGCTTCCGGCAGCGGCTGTACGGGCAGAACAACAACGGGCAGGTGGACCGGACG
CTGAACCCGGCGTACGCGGCTGAGCTGCGGGGGCGGTGCCCGCGGTCCGGCGGCGACCAGAACCTGTTCGCGCTGGACCAGGCGACGCAGTTCCGGTTCGACAACCTGTACTACCACAAC
ATCCTGGCCATGAACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGAGCCGCGAGACCATGGAGCTCGTCCACCGCTACGCCGCCGACCAGGGCCTCTTCTTCGACCACTTCGCC
AAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACCGGAACCGCCGGCGAGATCAGGCACAACTGCAGGAGGGTCAACCACTTCTAA

Retrieve as FASTA