Entry information : EgrPrx92 (Eucgr.L02524 / Egrandis_v1_0.041300m / peroxidase 64-like)
Entry ID 8030
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-02-10 (Christophe Dunand)
Peroxidase information: EgrPrx92 (Eucgr.L02524 / Egrandis_v1_0.041300m / peroxidase 64-like)
Name (synonym) EgrPrx92 (Eucgr.L02524 / Egrandis_v1_0.041300m / peroxidase 64-like)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx92
start..stop
S start..stop
EcamPrx92 650 0 1..316 1..316
EguPrx92 558 0 1..272 1..272
EglPrx92 556 0 1..270 1..270
CpapPrx26 532 0 4..316 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5707..5910 204 N° 2 5265..5453 189 N° 3 4961..5123 163 N° 4 4314..4708 395
complement(join(4314..4708,4961..5123,5265..5453,5707..5910))


exon

Literature and cross-references EgrPrx92 (Eucgr.L02524 / Egrandis_v1_0.041300m / peroxidase 64-like)
DNA ref. Phytozome 11:   scaffold_6 (21508487..21507032)
Protein sequence: EgrPrx92 (Eucgr.L02524 / Egrandis_v1_0.041300m / peroxidase 64-like)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33631.84 (31379.6)  
PI (pH):   %s   7.44 (7.75) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLVALVSAFLILQILSPVDALSTNYYDHTCPQLEATVTAAVKQAMMNDKTVPAALLRMHFHDCFIRGCDGSVLLNSTGGNTAEKDGPPNISLHAFYVIDNAKKAVEALCPGVVSCADILALAARDAVALSGGPTWNVPKGRLDGRTSKASDTRQLPAPIFNISQLQQSFSQRGLSMEDLVALSGGHTLGFAHCSSFQNRIHNFSPTTDVDPSLSPSFAANLRNVCPLGNTANNAGSTLDSTTTTFDNVYFKMLRQGQSIFSSDQALLTNPQTKALVSKFASSQQEFNKAFIQSMIKMSSLTGGQEIRLDCKVAR

Retrieve as FASTA  
Remarks Complete sequence from genomic (Egrandis_v1_0.041300m, scaffold_1002 and (Egrandis_v1_0.052395m, scaffold_6: 21507077 - 21508487, 3' end is missing due to undetermined nucleotides (Egraprx181, scaffold_6 (21508487..21507032) has been removed)=> incorrect prediction from Phytozome)).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCTAGTTGCTCTCGTCTCTGCTTTTCTCATCCTTCAAATTCTCTCTCCTGTCGACGCACTAAGTACAAACTACTATGACCACACTTGCCCCCAGCTCGAGGCTACGGTCACG
GCTGCTGTCAAGCAAGCCATGATGAATGACAAAACTGTTCCGGCTGCACTCTTGAGGATGCACTTCCACGACTGCTTCATTAGA
GTATACCTATTTCTCTACCTCTCCTTCTTAACCTTG
GTCTTTCTTTCCATCTTTGTATAGTAAAACCTGCCCATACGGATTCCTGATTCGTATGGTTAGTTGGGTATTCCATCGATCCGGATTGATCCCCTTATTTAAGGCTCCATGTCATAAAAC
AATGTATTTTACTCCATTGATGATCACTTCCTCATGTATAGCTTAGGTTATATATGTGGACTTCTATGATGTATGTTGGCTTCTTTATGAAAATTAGGGGTGTGATGGTTCTGTTCTGCT
GAACTCAACGGGAGGCAACACAGCAGAGAAAGATGGGCCTCCCAATATCTCACTGCATGCCTTCTACGTTATCGACAATGCGAAGAAGGCAGTGGAAGCACTGTGCCCCGGTGTCGTCTC
CTGTGCAGACATCTTGGCTCTCGCTGCTCGCGATGCTGTTGCTCTG
GTTCGTCCTCATAATTAGAATATGTCAATCTATATTGTGGTCATTTCGACTTGTGCGGTTCACTATTGCAAGAG
GAAAAAGTAAAATAAACTTCCAACTCATGATGAATTTTCTTTTCTATGTGATGTTCTCGGTGTATAGTCTGGAGGACCCACTTGGAATGTGCCAAAAGGGAGGCTAGATGGAAGAACATC
AAAGGCAAGTGACACCAGGCAATTACCAGCCCCCATCTTCAACATCTCTCAACTCCAACAGAGTTTCTCCCAGAGAGGCCTTTCCATGGAAGATTTAGTGGCTCTATCAG
GTAAGACATT
ACACAAGCGTTTGGTAAAACTTTTAAAAGTTAAAAGGTTTGAATGGGTCAACATTTTTTCGCCTAGATTTGATTGCGATTTCAACTATGAAAAAGATTACATTTGCCTACTTTGCACTAT
CCATTCACAGGATACTTTTTTGACATGACCACTTAGTTTTTAATCGCATCATCACAGGATGTGATTTGGCAGCTACGCCGTGTTACCGTCATGTAACATTACTTTTATCCGCATGCATGC
AGGAGGCCACACGCTGGGATTCGCTCACTGCTCATCGTTCCAAAACAGGATACACAACTTCAGCCCCACCACCGACGTGGACCCATCGCTGAGCCCATCCTTCGCGGCGAACCTACGCAA
CGTGTGCCCGTTGGGCAACACGGCAAACAATGCCGGATCGACGCTGGACTCAACCACCACCACCTTCGACAATGTCTACTTCAAGATGCTGCGTCAGGGCCAGAGCATCTTCTCTTCGGA
TCAAGCCCTGCTCACGAACCCGCAGACCAAGGCCTTGGTCTCCAAGTTCGCGAGCTCGCAGCAGGAGTTCAATAAGGCCTTCATCCAGTCCATGATCAAGATGAGCAGCTTGACCGGCGG
CCAAGAGATTAGGCTCGACTGCAAAGTGGCTCGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCTAGTTGCTCTCGTCTCTGCTTTTCTCATCCTTCAAATTCTCTCTCCTGTCGACGCACTAAGTACAAACTACTATGACCACACTTGCCCCCAGCTCGAGGCTACGGTCACG
GCTGCTGTCAAGCAAGCCATGATGAATGACAAAACTGTTCCGGCTGCACTCTTGAGGATGCACTTCCACGACTGCTTCATTAGA
GGGTGTGATGGTTCTGTTCTGCTGAACTCAACGGGA
GGCAACACAGCAGAGAAAGATGGGCCTCCCAATATCTCACTGCATGCCTTCTACGTTATCGACAATGCGAAGAAGGCAGTGGAAGCACTGTGCCCCGGTGTCGTCTCCTGTGCAGACATC
TTGGCTCTCGCTGCTCGCGATGCTGTTGCTCTG
TCTGGAGGACCCACTTGGAATGTGCCAAAAGGGAGGCTAGATGGAAGAACATCAAAGGCAAGTGACACCAGGCAATTACCAGCCCCC
ATCTTCAACATCTCTCAACTCCAACAGAGTTTCTCCCAGAGAGGCCTTTCCATGGAAGATTTAGTGGCTCTATCAG
GAGGCCACACGCTGGGATTCGCTCACTGCTCATCGTTCCAAAAC
AGGATACACAACTTCAGCCCCACCACCGACGTGGACCCATCGCTGAGCCCATCCTTCGCGGCGAACCTACGCAACGTGTGCCCGTTGGGCAACACGGCAAACAATGCCGGATCGACGCTG
GACTCAACCACCACCACCTTCGACAATGTCTACTTCAAGATGCTGCGTCAGGGCCAGAGCATCTTCTCTTCGGATCAAGCCCTGCTCACGAACCCGCAGACCAAGGCCTTGGTCTCCAAG
TTCGCGAGCTCGCAGCAGGAGTTCAATAAGGCCTTCATCCAGTCCATGATCAAGATGAGCAGCTTGACCGGCGGCCAAGAGATTAGGCTCGACTGCAAAGTGGCTCGTTAG

Retrieve as FASTA