Entry information : EgrPrx74 (Eucgr.D00818 / Egrandis_v1_0.041098m)
Entry ID 8035
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-17 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx74 (Eucgr.D00818 / Egrandis_v1_0.041098m)
Name (synonym) EgrPrx74 (Eucgr.D00818 / Egrandis_v1_0.041098m)
Class Class III peroxidase    [Orthogroup: Prx065]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx74
start..stop
S start..stop
EcamPrx74 662 0 1..321 15..335
EglPrx74 660 0 1..321 1..321
EguPrx74 537 0 58..321 1..264
LuPrx100 446 7e-159 3..317 13..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15204283..15204453 171 N° 2 15203195..15203543 349 N° 3 15202663..15203108 446  
complement(join(15202663..15203108,15203195..15203543,15204283..15204453))


exon

Literature and cross-references EgrPrx74 (Eucgr.D00818 / Egrandis_v1_0.041098m)
DNA ref. Phytozome 12:   scaffold_4 (15204453..15202663)
Protein sequence: EgrPrx74 (Eucgr.D00818 / Egrandis_v1_0.041098m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321
PWM (Da):   %s   34701.5  
PI (pH):   %s   7.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMVVAAAAAQLQVHFYKDSCPQAELVVKGIMQQRFSADPSIPAGLLRMHFHDCFIRGCDGSVLIDSNGNRVAEKDAPPNLTLRGFEVIDQIKAELEKQCKGIVSCADILALATRDGVALTGGSAYALPTGRRDGTVSNISDVHIPGPSFSVAAAASAMQTINLSLEDLVTLLGAHAMGFCQCGFFVDRLYNFLGSGQADPNIDPQFLGVLRQKCPRPDPSVPFNLSTDPKIFMTPSSSTPFKLDTSFYRGVLNEQATLQLDQELAFTDLTRRMAADYISQPNAFRRKFAKAMIKLGNVNVLTGQQGEIRANCRKFNQPSH

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATGGTGGTGGCGGCGGCGGCAGCACAGCTGCAGGTGCATTTCTATAAGGACTCGTGTCCTCAAGCTGAGCTGGTGGTGAAGGGGATAATGCAGCAGCGCTTCAGCGCCGACCCG
TCTATTCCCGCGGGTTTGCTTCGTATGCATTTTCACGACTGCTTCATCCGT
GTAACTCCTCTCTCTCTCTCTCTCACAAAGATACATTTTCTTTCTATGATATCAACAAATGATTTTCCT
TATGTTTTCTCTCTTACTTTCTTTGGATGATTTCTTTTGTCACTTCGTGTACAGTTAATTTCGTTGGGACTGTAAATGGGATGTATTTTCTCATAGTAATGTTGAATTGCCTTTCCAAAA
ATTTAATCTTTAATCGATATTCTCGCTGTCTTCTTATTCATCGTCCTTTCCTACAGTTAGCACGGATTTCTAATTATTATTCCACCTCATAATGTTTTTTCTTCTTTTGATAATATTAAA
AACTTGTTAGCTACACATATATATCAAGAAAGGAAAAAAATAATAGAAGACCCCAATTTATATTTCATACAATAAAAAATACTAGCAAATTTGTCCTCTTTTTTATTACCCTAAGCATTC
CCAGGAGGTTTTTTTTTTTTGGATCGAAAACGGAAAATATATTATAACTTTAGAAGCTTACAACTAGACAGTAAAGCATCAGTATATACAAGATCTAGCAAAATGTCAAAGGAATTACAT
CAATTGACTAGGTACAATTCTCTCATTAAATTATGCACCTACATATTATATCTTAGCACATGCGCTTTATCATCCAGCTCATCAAGTAGTAAGCATCCAATGCTTGAACTACGGTACTAT
ACATCTCCAGACATTTTTAACATTTTTCTAATAAACTAATATTTCGTCCTCTTCTGTTTACCGCGATTAGGGTTGCGATGGCTCGGTCCTCATAGACAGTAATGGCAACAGGGTGGCCGA
AAAAGATGCACCTCCTAATTTGACCCTAAGGGGGTTTGAGGTCATCGACCAGATAAAAGCCGAGCTAGAGAAGCAGTGCAAGGGGATCGTTTCTTGTGCGGATATATTGGCCCTAGCCAC
CCGAGACGGCGTTGCCCTAACCGGAGGGTCGGCCTATGCTCTTCCCACCGGACGAAGGGACGGGACGGTCTCGAACATCAGCGACGTTCATATTCCTGGACCATCCTTTTCCGTTGCTGC
GGCAGCTAGTGCCATGCAAACTATCAACCTCTCCCTAGAAGATCTTGTCACTTTATTAG
GTAAAGCAACGTTCACTTGCTCGAATCCTCAATCTGTAAATAGGACAAGACATGCTTATTG
ATAAGAAGATGATATCTATGGCCAGGGGCACATGCGATGGGATTTTGCCAGTGCGGTTTCTTTGTGGACCGGCTCTACAACTTCTTAGGTTCGGGTCAAGCCGACCCGAATATCGACCCG
CAATTCCTGGGCGTCCTGAGGCAAAAATGTCCGCGACCCGACCCCAGTGTCCCGTTCAATCTCAGTACCGACCCCAAGATCTTCATGACGCCATCGTCCAGCACACCTTTCAAGCTCGAC
ACTTCGTTCTATCGAGGGGTCCTCAATGAACAGGCAACTCTTCAGTTGGATCAAGAGCTGGCGTTCACCGACCTCACGCGCCGGATGGCGGCGGACTACATCAGCCAACCCAACGCGTTC
CGGCGGAAATTCGCCAAGGCAATGATCAAGCTGGGGAATGTGAATGTTTTGACTGGACAGCAGGGAGAGATTAGAGCAAACTGTAGGAAATTCAATCAACCAAGTCATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATGGTGGTGGCGGCGGCGGCAGCACAGCTGCAGGTGCATTTCTATAAGGACTCGTGTCCTCAAGCTGAGCTGGTGGTGAAGGGGATAATGCAGCAGCGCTTCAGCGCCGACCCG
TCTATTCCCGCGGGTTTGCTTCGTATGCATTTTCACGACTGCTTCATCCGT
GGTTGCGATGGCTCGGTCCTCATAGACAGTAATGGCAACAGGGTGGCCGAAAAAGATGCACCTCCTAAT
TTGACCCTAAGGGGGTTTGAGGTCATCGACCAGATAAAAGCCGAGCTAGAGAAGCAGTGCAAGGGGATCGTTTCTTGTGCGGATATATTGGCCCTAGCCACCCGAGACGGCGTTGCCCTA
ACCGGAGGGTCGGCCTATGCTCTTCCCACCGGACGAAGGGACGGGACGGTCTCGAACATCAGCGACGTTCATATTCCTGGACCATCCTTTTCCGTTGCTGCGGCAGCTAGTGCCATGCAA
ACTATCAACCTCTCCCTAGAAGATCTTGTCACTTTATTAG
GGGCACATGCGATGGGATTTTGCCAGTGCGGTTTCTTTGTGGACCGGCTCTACAACTTCTTAGGTTCGGGTCAAGCCGAC
CCGAATATCGACCCGCAATTCCTGGGCGTCCTGAGGCAAAAATGTCCGCGACCCGACCCCAGTGTCCCGTTCAATCTCAGTACCGACCCCAAGATCTTCATGACGCCATCGTCCAGCACA
CCTTTCAAGCTCGACACTTCGTTCTATCGAGGGGTCCTCAATGAACAGGCAACTCTTCAGTTGGATCAAGAGCTGGCGTTCACCGACCTCACGCGCCGGATGGCGGCGGACTACATCAGC
CAACCCAACGCGTTCCGGCGGAAATTCGCCAAGGCAATGATCAAGCTGGGGAATGTGAATGTTTTGACTGGACAGCAGGGAGAGATTAGAGCAAACTGTAGGAAATTCAATCAACCAAGT
CATTGA

Retrieve as FASTA