Entry information : HaPrxII01 (HanXRQChr08g0228231)
Entry ID 8042
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2016-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrxII01 (HanXRQChr08g0228231)
Name (synonym) HaPrxII01 (HanXRQChr08g0228231)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrxII01
start..stop
S start..stop
VvPrxII05 311 2e-109 34..204 40..210
PtPrxII05 305 7e-107 6..206 3..218
PtrtrPrxII05 305 1e-106 6..206 3..218
CclPrxII04 303 6e-106 6..206 26..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93846651..93847265 615 N° 2 93846556..93846594 39  
complement(join(93846556..93846594,93846651..93847265))


exon

Literature and cross-references HaPrxII01 (HanXRQChr08g0228231)
DNA ref. HanXRQ genome:   HanXRQChr08 (93847265..93846556)
EST ref. GenBank:   DY918118.1
Protein sequence: HaPrxII01 (HanXRQChr08g0228231)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23025.75  
PI (pH):   %s   7.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATATASLSFTRLLSSATKPHRSFTHHHRSLSFKPLKFSTKISATISVGDKLPDATLSYFDSSDELQTTTISDLTKSKKTILFAVPGAFTPTCSQKHLPGFVEKSGELKSKGVDTIACVSVNDAFVMKAWKADLGIGDEVLLLSDGNGEFTRAIGCELDLSDKPVGLGVRSRRYAMLVEDGVVKVLNLEEGGAFTSSGAEDMLKAVNNVSCDVGCLV*

Retrieve as FASTA  
Remarks Complete sequence from EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCGCAACCGCTTCACTCTCCTTCACCAGACTCCTCTCTTCCGCCACCAAACCCCACCGCTCCTTCACCCACCACCACCGCTCCCTCTCCTTCAAACCCCTCAAATTCTCCACC
AAAATCTCCGCCACCATCTCCGTCGGCGACAAACTCCCTGACGCCACCTTATCCTACTTCGACTCCTCCGACGAACTCCAAACCACCACCATCTCCGACCTCACCAAATCCAAAAAAACC
ATCTTATTCGCCGTCCCGGGCGCCTTCACACCCACCTGCTCCCAAAAACACCTTCCGGGATTCGTGGAAAAATCCGGCGAGTTAAAATCAAAGGGTGTGGATACAATCGCGTGTGTTTCG
GTTAACGATGCGTTTGTGATGAAGGCTTGGAAGGCTGATTTGGGAATTGGGGATGAAGTGTTGCTACTGTCTGATGGGAATGGGGAGTTTACTCGAGCCATTGGGTGTGAACTGGATTTG
AGTGATAAACCGGTTGGGTTAGGGGTGAGGTCCAGGAGGTATGCTATGCTTGTTGAAGATGGGGTTGTTAAGGTGTTGAATCTTGAAGAAGGTGGGGCTTTTACTTCTAGTGGTGCTGAG
GATATGCTTAAAGCT
GTTTGATTGAGGTTTGTTTTGTAAGTGGTTGTTGCTTACGTGCTTGTTTTTTTTAGGTTAATAATGTGAGTTGTGATGTTGGATGCTTGGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCGCAACCGCTTCACTCTCCTTCACCAGACTCCTCTCTTCCGCCACCAAACCCCACCGCTCCTTCACCCACCACCACCGCTCCCTCTCCTTCAAACCCCTCAAATTCTCCACC
AAAATCTCCGCCACCATCTCCGTCGGCGACAAACTCCCTGACGCCACCTTATCCTACTTCGACTCCTCCGACGAACTCCAAACCACCACCATCTCCGACCTCACCAAATCCAAAAAAACC
ATCTTATTCGCCGTCCCGGGCGCCTTCACACCCACCTGCTCCCAAAAACACCTTCCGGGATTCGTGGAAAAATCCGGCGAGTTAAAATCAAAGGGTGTGGATACAATCGCGTGTGTTTCG
GTTAACGATGCGTTTGTGATGAAGGCTTGGAAGGCTGATTTGGGAATTGGGGATGAAGTGTTGCTACTGTCTGATGGGAATGGGGAGTTTACTCGAGCCATTGGGTGTGAACTGGATTTG
AGTGATAAACCGGTTGGGTTAGGGGTGAGGTCCAGGAGGTATGCTATGCTTGTTGAAGATGGGGTTGTTAAGGTGTTGAATCTTGAAGAAGGTGGGGCTTTTACTTCTAGTGGTGCTGAG
GATATGCTTAAAGCT
GTTAATAATGTGAGTTGTGATGTTGGATGCTTGGTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCACCACAAC TACCACCGCC ATGGCCACCG CAACCGCTTC ACTCTCCTTC ACCAGACTCC TCTCTTCCGC CACCAAACCC CACCGCTCCT TCACCCACCA CCACCGCTCC CTCTCCTTCA  AACCCCTCAA ATTCTCCACC AAAATCTCCG CCACCATCTC CGTCGGCGAC AAACTCCCTG ACGCCACCTT ATCCTACTTC GACTCCTCCG ACGAACTCCA AACCACCACC ATCTCCGACC  TCACCAAATC CAAAAAAACC ATCTTATTCG CCGTCCCGGG CGCCTTCACA CCCACCTGCT CCCAAAAACA CCTTCCGGGA TTCGTGGAAA AATCCGGCGA GTTAAAATCA AAGGGTGTGG  ATACAATCGC GTGTGTTTCG GTTAACGATG CGTTTGTGAT GAAGGCTTGG AAGGCTGATT TGGGAATTGG GGATGAAGTG TTGCTACTGT CTGATGGGAA TGGGGAGTTT ACTCGAGCCA  TTGGGTGTGA ACTGGATTTG AGTGATAAAC CGGTTGGGTT AGGGGTGAGG TCCAGGAGGT ATGCTATGCT TGTTGAAGAT GGGGTTGTTA AGGTGTTGAA TCTTGAAGAA GGTGGGGCTT 
TTACTTCTAG TGGTGCTGAG GATATGCTTA AAGCTGTTAA TAATGTGAGT TGTGATGTTG GATGCTTGGT TTAGGATGTT TGGATTGAGA AATA 

Retrieve as FASTA