Entry information : EgrPrx105 (Eucgr.G01642 / Egrandis_v1_0.018505m)
Entry ID 8049
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx105 (Eucgr.G01642 / Egrandis_v1_0.018505m)
Name (synonym) EgrPrx105 (Eucgr.G01642 / Egrandis_v1_0.018505m)
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx105
start..stop
S start..stop
EcamPrx105 699 0 1..339 1..339
EguPrx105 690 0 1..339 1..339
EglPrx105 654 0 1..339 1..339
EgrPrx109 639 0 1..339 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29590670..29590906 237 N° 2 29591075..29591266 192 N° 3 29591419..29591584 166 N° 4 29591739..29592163 425
join(29590670..29590906,29591075..29591266,29591419..29591584,29591739..29592163 )


exon

Literature and cross-references EgrPrx105 (Eucgr.G01642 / Egrandis_v1_0.018505m)
DNA ref. Phytozome 12:   scaffold_7 (29590670..29592163)
Protein sequence: EgrPrx105 (Eucgr.G01642 / Egrandis_v1_0.018505m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (309)
PWM (Da):   %s   36929.57 (33657.8)  
PI (pH):   %s   5.01 (4.69) Peptide Signal:   %s   cut: 31 range:31-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALYHPRILTMQFLAAIAFISGIIRSGASDPPLTLDYYASSCPNVLEIIRQEMEHEVLSDPHNAALVLRLHFHDCFVQGCDGSVLLDDTVMLRGEKTASPNINSLKGFEIIDRIKSKVESQCPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRSASYELANTNIPTPNQGLISIIYKFLYLGLSVTDTVALSGAHTIGVARCENFRARIYGDYELTSGGSPLSEVHLSQLKSKCPAAGGGDNNTAPLDYETPNTFDNSYYHLLLNGEGLLNSDQELYSSALALQTKQLVEQYALDVAAFFQQFSVSMVKMGNLTNPDSFLNGEVRKSCRFINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GTG
CATTGCTTATATCGTAACTCTACGCAATTTTATATTCTGTTGTGTTAAATTGAACATGTACTTTGGGATGAAAGTATGCGTTAGTAGTGACAACCATCTTGAAGCATGGATCAATCTGCA
AAGGGAGAGTGTTTTCTGAATGTTTTGGATGCGCTGTTTTATTAGGGATGTGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCTCCAAATATAAAC
TCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAATCCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTA
TAGATTGTCCCCTCTCTTTCTCTCTGAATTCCTCATTGACATGTCAAATAATGTTCCGAATTATAACTTCTGTAGTTATTACTTGCTAACCGAGGAGAAATATCAGAAAATCAATGTGAC
TGATATCGATTATCTTTCGTACTTGTTAGGTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGCGCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGA
ATCAAGGCCTCATTTCCATCATTTACAAGTTCCTTTACCTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GTAATTATTAAGTTCCTACTCCTTTTCAAGTGATCGACCGAATTA
CTCACCCAAGGTGAGCTTATTGCCACAGAAGAAAGCGCGCTGATTAAGACTTGTATAGTACATTGCATGAGACTTTCCTTTTAACTATAATGCACATGTGAATCGCTAGGGGCTCACACG
ATCGGCGTGGCACGCTGTGAGAACTTCCGTGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTCAGCCAATTGAAGTCCAAATGCCCGGCC
GCAGGAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAGGAACTG
TACTCAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTTGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACGAATCCG
GATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GGA
TGTGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCTCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAA
TCCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGC
GCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTTCCATCATTTACAAGTTCCTTTACCTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GGGCT
CACACGATCGGCGTGGCACGCTGTGAGAACTTCCGTGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTCAGCCAATTGAAGTCCAAATGC
CCGGCCGCAGGAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAG
GAACTGTACTCAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTTGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACG
AATCCGGATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCTTGA

Retrieve as FASTA