Entry information : EgrPrx[P]106
Entry ID 8055
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2012-02-28 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EgrPrx[P]106
Name EgrPrx[P]106
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]106
start..stop
S start..stop
EgrPrx[P]108 171 3e-57 1..84 1..84
EcamPrx[P]108 154 1e-50 1..77 51..127
EguPrx[P]107 155 3e-50 1..77 93..169
EgrPrx[P]107 155 3e-50 1..77 93..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40520850..40521098 249 N° 2 40520719..40520772 54  
complement(join(40520719..40520772,40520850..40521098))


exon

Literature and cross-references EgrPrx[P]106
DNA ref. Phytozome 12:   scaffold_7 (40521098..40520719)
Protein sequence: EgrPrx[P]106
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   100
PWM (Da):   %s   11486.69  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RNDDGVIDQEDPTLGLEYDFYRHTCPATKELVRSSMSRVYSQRPEVAPALLRLLFHDCFIRGCDASVLMDGSHGNRSPLWGGPEKERKKKEEMEKRRRNK*

Retrieve as FASTA  
Remarks Pseudogene from genomic (part of exons 1 and 2). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGAACGATGATGGGGTCATCGACCAAGAAGACCCCACGCTCGGGCTCGAATACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAACTTGTGAGGTCATCCATGTCCAGAGTCTAC
TCCCAACGACCCGAAGTTGCCCCTGCGCTTCTCCGTCTCCTCTTCCACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGCCCCCTGTGG
GGCGGGCCA
GTCCTGGCCCCCACTCGATGTGGCGGGGCGGCCCTCACCAGCCCGGCCCGGGCTTCCCTTGTCGATGGCCTGCCAAGGAAAAAGAAAGGAAAAAGAAAGAAGAAATGGAAA
AAAGAAGAAGGAATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGAACGATGATGGGGTCATCGACCAAGAAGACCCCACGCTCGGGCTCGAATACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAACTTGTGAGGTCATCCATGTCCAGAGTCTAC
TCCCAACGACCCGAAGTTGCCCCTGCGCTTCTCCGTCTCCTCTTCCACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGCCCCCTGTGG
GGCGGGCCA
GAAAAAGAAAGGAAAAAGAAAGAAGAAATGGAAAAAAGAAGAAGGAATAAATAA

Retrieve as FASTA