Entry information : EgrPrx[P]108
Entry ID 8059
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-02-28 (Qiang Li)
Peroxidase information: EgrPrx[P]108
Name EgrPrx[P]108
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]108
start..stop
S start..stop
EgrPrx[P]106 169 2e-56 1..83 1..83
EglPrx[P]108 154 9e-51 30..109 1..77
EcamPrx[P]108 152 2e-49 1..77 51..127
EguPrx[P]107 152 5e-49 1..77 93..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40765567..40765815 249 N° 2 40764747..40764842 96  
complement(join(40764747..40764842,40765567..40765815))


exon

Literature and cross-references EgrPrx[P]108
DNA ref. Phytozome 11:   scaffold_7 (40765815..40764747)
Protein sequence: EgrPrx[P]108
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   114
PWM (Da):   %s   12987.45  
PI (pH):   %s   6.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RNNDGVNDQEDPALGLEYDFYRHTCPATKEIVRSSMSRVYSQRPEVAPALLRLLFHDCFIRGCDASVLMDGSHGNRSPLWGGPNPLDNVILLWLQPVRVYYCPYPLVQIYIVNS*

Retrieve as FASTA  
Remarks Pseudogene from genomic (part of exon 1 and beginning of exon 2). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGAACAATGATGGCGTCAACGACCAAGAAGACCCCGCGCTCGGGCTCGAATACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAAATCGTGAGGTCATCCATGTCCAGAGTCTAC
TCCCAACGCCCCGAAGTTGCCCCTGCGCTTCTCCGTCTCCTCTTCCACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGCCCCCTGTGG
GGCGGGCCG
GTCCTGGCCCCCACTCAATGTGACAGAGCGGCACTCACCAACCTGGCCCAGGCTTCCCTCATTGATGGCTGGCAGAGGAAAATGAAAGGAAAAAGAAAGAAGAAATGGAAA
AACAAAAGAAAAGGAATAAATAAATAATTTTTAAAAATATGAAAATATTATCAAAAATTGTCTTCATCAACAACCATCATGTGCCACATAGAACGACCAGCATTCACATAAAAAAATTTC
GGCCAAAATTGATCAGATTAACTCAAGTGAACAAAAAGTAAAAAGATTTAAAACTTAATTGACAAAATTGAAAAATTTATGATTGAATAGTAAAAATGCAATAAATTTAAGACTTTTTGG
ACAATTTTCTTGATTTATTTTCTGTTTGTCTTGCGTGTGCACAGCATGGGGACATATAATAGATGGTTGTCCCCACTTAGAAGAACTAACAAGGCACCATCCCTAACTTGATCTCCAAGT
TTGGGCTATAGTATGTTTTTTCTTTTTCTTAGTGCATCAACCTCAGCACAACACGACCGTCGCTAATCAACTGTCGAATGTCAAATGTCTTCTTGTGGATTGGGTTGTGTCGGAGTGGTT
AAGGTAGAAAAAGTCTGGATGACTATGATCCATTGGGACCCCAAGAAGCCTATGATCCCTTTACTATCGAAGGGGTCCATCTCATTGACCAATGTCGGTGTTGACCTAACCTTTTGATGT
TGATCAATTTGAGAATCCTCTTGACAATGTTATCCTCTTATGGCTACAACCCGTGAGAGTTTACTATTGTCCTTACCCATTAGTGCAAATTTATATAGTTAATTCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGAACAATGATGGCGTCAACGACCAAGAAGACCCCGCGCTCGGGCTCGAATACGACTTCTACCGCCACACGTGCCCTGCTACTAAAGAAATCGTGAGGTCATCCATGTCCAGAGTCTAC
TCCCAACGCCCCGAAGTTGCCCCTGCGCTTCTCCGTCTCCTCTTCCACGATTGCTTCATCAGGGGTTGCGATGCTTCAGTTCTCATGGACGGTAGCCATGGAAACCGAAGCCCCCTGTGG
GGCGGGCCG
AATCCTCTTGACAATGTTATCCTCTTATGGCTACAACCCGTGAGAGTTTACTATTGTCCTTACCCATTAGTGCAAATTTATATAGTTAATTCCTAG

Retrieve as FASTA