Entry information : EgrPrx82 (Eucgr.E03708 / Egrandis_v1_0.043650m)
Entry ID 8066
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-01 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx82 (Eucgr.E03708 / Egrandis_v1_0.043650m)
Name (synonym) EgrPrx82 (Eucgr.E03708 / Egrandis_v1_0.043650m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx82
start..stop
S start..stop
EgrPrx88 669 0 1..327 1..327
EglPrx82 668 0 1..327 1..327
EcamPrx82 663 0 1..327 1..327
EguPrx82 651 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64874042..64874266 225 N° 2 64874528..64874713 186 N° 3 64874986..64875151 166 N° 4 64875329..64875735 407
join(64874042..64874266,64874528..64874713,64874986..64875151,64875329..64875735 )


exon

Literature and cross-references EgrPrx82 (Eucgr.E03708 / Egrandis_v1_0.043650m)
DNA ref. Phytozome 11:   scaffold_5 (64874042..64875735)
Protein sequence: EgrPrx82 (Eucgr.E03708 / Egrandis_v1_0.043650m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35285.23 (32284.6)  
PI (pH):   %s   8.69 (8.90) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLVQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVIGQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAPPNFSLRGYQVIDRVKTALEKACPGIVSCADVLAIVARDVIVATRGLSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSQTKAFIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATTGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTTGTGCTTAGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAAAGAATGGTTTTTACTTTCGTCGAACCATCTGCTAAACATCAATTAGA
ACAGGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACATACTTTTCTAGATTCGTCCGTGGATACGAACTGTTTTCTGCGTGAACTCACAGTTGAATAGTGTTTCTTTCTGGGTTCTT
CCACAGGGTTGCGAAGGTTCAATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCATCGTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCATAGTCGCG
GTACGCATATGCATATGTCACATGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCTGTAGAAATCTCGATTTTCACAAACAATCCATGCTCTCTCGTTGGAAAAAATACTCCGCCCATACTTATCTTCGGAGCTAATTACTGCTTGTCAA
AACCGAGATTATTTTTTCGTCGTGCATCATAAAACTCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGGAATTGAGTTTCTTTTTGTTGTCACTTTAGACCAGAGGCCTTTCCT
ATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCC
TCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAATACCTAATCTTCAATTATTGCTTCATATGCTTTATCAATTATTTTGTGGAAATTGACATAAATTAATAGGAAGAACTATAATTTGA
GCACGAGATTCATAAACAGTCTGCACTGCGAGGAGAAAACGTAATTTGTAAAGTTAGATCATGATAATTCTGATTTCTATTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCTT
CCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTCGTTG
AGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACCAAGGCATTCA
TTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTG
CAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATTGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCATC
GTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCATAGTCGCG
ACCAGAGGCCTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTCGTTGAGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACC
AAGGCATTCATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAATTAA

Retrieve as FASTA