Entry information : EgrPrx83 (Eucgr.E03715 / Egrandis_v1_0.019236m)
Entry ID 8067
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx83 (Eucgr.E03715 / Egrandis_v1_0.019236m)
Name (synonym) EgrPrx83 (Eucgr.E03715 / Egrandis_v1_0.019236m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx83
start..stop
S start..stop
EguPrx83 639 0 1..327 1..327
EcamPrx87 639 0 1..327 1..327
EgrPrx87 623 0 1..327 1..327
EglPrx87 621 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65093384..65093608 225 N° 2 65094009..65094194 186 N° 3 65094462..65094627 166 N° 4 65094810..65095216 407
join(65093384..65093608,65094009..65094194,65094462..65094627,65094810..65095216 )


exon

Literature and cross-references EgrPrx83 (Eucgr.E03715 / Egrandis_v1_0.019236m)
DNA ref. Phytozome 11:   scaffold_5 (65093384..65095216)
Protein sequence: EgrPrx83 (Eucgr.E03715 / Egrandis_v1_0.019236m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35348.04 (32273.4)  
PI (pH):   %s   8.09 (8.20) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSKLFLSCLLVQLTFLFLVPEVAHGQGLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTNQAEKNAIPNQSLRGFQTIDRVKTALEKACPGIVSCADILALVARDMVVATGGFSYDVETGRRDGNVSIMNEALNDLIPPTANITTLKADFAKRGLSVKDLVVLSGGHTIGTSHCSSFSNRVYNFTGKGDADPTLDSNYIARLKLRCKPNDQTTLVEMDPGSVRTFDVKYFDLIPKRRGLFTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCACGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCG
AGCTTACGTGTTTCTCGTCCTACCACAAGTGTAACTCGTCCTACTACGAGTGTAAAGTTTACCATTTTCTAATTACGTGATTCTTTGCATGTAACTAATGTTCGGATTCTAAGGTGAAAA
ACTTACTGGCAAAAAATGAGCGTGAGAATTTAGATCTTGGGCTTTCATCTGAAGGGGTAATGCATGGTAGGAATGCATAGAGATTTACAAAATTGATTTACTGGATAACAATATGATAAA
ATGGAAAATGTGTATCAGAACTAGTTATGTACTAGTAAATGGTGTTTGGCTCCTCAACATACTTCTCTAGATTCGTCCTTGGTTACGAACTACTGTCTTCATGAACTCACGGTTGAATCA
TCTTTTGTTCTGGGCCTCTCCACAGGGCTGCGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAAGCCGAAAAGAACGCAATTCCCAATCAAAGTCTTCGAGGTTTCCAAACGATCGA
TAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATCGTCTCATGTGCTGACATCTTGGCCCTCGTCGCTAGAGACATGGTCGTCGCG
GTGAGCATATGCATACATTACCTCCTTTA
TTTTTTCGTTTAAATTTTAATGTTTGTTATATAATTAGGACGTTAGTAGAATTCTTGATTTCACAAACGATCTGCGTTATCTCATTGAAAAACGAATTCTAGCCATACATATTATGGGAT
CCAAGTATCGCTTGTTGATATTAAGATTATTTTTATAGCGCTCTTGATAAAACACGACTATGTTATATTTTAATGAGAAAAACATTCTTATATATATATATTTGGTGTTCTCTTTTAGAC
TGGAGGTTTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCATGAACGAGGCACTTAACGATTTAATACCACCTACGGCCAACATTACAACTCTGAAAGCAGATTT
TGCAAAGCGAGGCCTCAGTGTGAAGGACCTTGTCGTCTTGTCAG
GTAACACCTAATCTCCAATTATTGCTCCATATGCTTTGTCAATTATTTTGTGGGGATTGACATAAATTAATCGGGA
AGACATTGTAATTTGAGTGCGTGATTCATAAACATCGTCAGCACTACAACGAGAGAACATAATTTGTTTAGTTAGATCATGCTAATTCTGATTTCCAATTGACCAGGTGGGCACACCATT
GGAACTTCACACTGCTCTTCCTTCTCCAACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAAT
GATCAAACCACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGAC
AGCGAAACCAAGGCGTACATTGACCTCCAGATCAAGACCGGTGGGTCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGC
GAAGTCAGAAAAGTGTGCTCAAAGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCACGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GGCTGCGAAGGTTCG
GTACTATTGAACTCTCCGACCAATCAAGCCGAAAAGAACGCAATTCCCAATCAAAGTCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATC
GTCTCATGTGCTGACATCTTGGCCCTCGTCGCTAGAGACATGGTCGTCGCG
ACTGGAGGTTTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCATGAACGAGGCA
CTTAACGATTTAATACCACCTACGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGCGAGGCCTCAGTGTGAAGGACCTTGTCGTCTTGTCAG
GTGGGCACACCATTGGAACTTCA
CACTGCTCTTCCTTCTCCAACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAATGATCAAACC
ACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGACAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGGTCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGCGAAGTCAGA
AAAGTGTGCTCAAAGGTCAATTAA

Retrieve as FASTA