Entry information : EgrAPx[P]06 (Eucgr.E00760 / Egrandis_v1_0.050796m)
Entry ID 8070
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-11 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2012-02-27 (Qiang Li)
Peroxidase information: EgrAPx[P]06 (Eucgr.E00760 / Egrandis_v1_0.050796m)
Name (synonym) EgrAPx[P]06 (Eucgr.E00760 / Egrandis_v1_0.050796m)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx[P]06
start..stop
S start..stop
EglAPx[P]06 240 6e-84 1..124 1..124
EguAPx[P]05 231 3e-80 1..132 1..132
EgrAPx[P]05 224 2e-77 1..132 1..132
EgrAPx[P]04 219 4e-75 1..117 40..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7777038..7777088 51 N° 2 7776872..7776951 80 N° 3 7776680..7776782 103 N° 4 7775941..7776102 162
complement(join(7775941..7776102,7776680..7776782,7776872..7776951,7777038..7777 088))


exon

Literature and cross-references EgrAPx[P]06 (Eucgr.E00760 / Egrandis_v1_0.050796m)
DNA ref. Phytozome 11:   scaffold_5 (7777088..7775941)
Protein sequence: EgrAPx[P]06 (Eucgr.E00760 / Egrandis_v1_0.050796m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   131
PWM (Da):   %s   13996.33 Transmb domain:   %s   i108-130o
PI (pH):   %s   6.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSEKDIVALSGAHTLGRAHQERSGFDGPWTQEPLKFDNSYFVELLKGEA*GLLKLPTDKALLENPAFRPYVELYADEDAIFRDYAISHKKLSELGFMPSSSRSKTVANGAILAQGAVGVAVAAAVVILS

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Only exon 4 with stop codon in frame). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGAGAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTGTTATTTT
TTTATTCTTGTGTCTAGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACTGG
ATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGAAGCATAGGGGCTGCTGAAACTGCCAACTGACAAGGC
ATTGCTGGAAAATCCTGCATTTCGCCCTTATGTGGAGTTGTATGCGAAG
GTAAATAAGCTTTTCGCGTGGTCTGGTGACTCCATCGATAAATCTATAAAATTGAATTGCAGTTACATGGT
TTCCTTTTGTAAATTTGTTTTTGATGAAACTACCCCGCCCACACCACTATTTCGTTTCCTTATGCTCATGGTCTATAACCCTTTGATGCTACTGTCCTTGGTTTTGCCGAGAATGAAAAG
AGATGGAAAGTGTTTTTCATGGAATTTATGCTGTGTAGGCTTGTGATGCTTAAAAGTAAGCATTCAATATGTTCCATCACTATCTTCTATGTAGAGACCAGGAAATATTCATGATGAGAT
CGCACATCAAATGTTGGGTAGATACATACATGTGTTGGGATGGATATATTATGTGGTTCCCTGAAACCTCTAGGCTAGAGCATCATCTTTGTGCTACTGGGAACACCTGATTTGATATTT
GAATTGGTTGTTGTTCCCGCAACTCTCTCATGGTGGTTGGCACGACCTTGAAAAGAGACAAACGGACAATTTGATACCGTGCTTCTTTTCCTCGTTTTCTTTTGCTATATGCTCTTCTTT
CCCTAATGTTGTCAAGCATGTGGCAGGATGAGGATGCAATTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTCTGAACTGGGGTTCATGCCAAGTTCTTCACGCAGCAAGACAGTAG
CGAATGGTGCCATATTGGCACAAGGTGCTGTTGGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGAGAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCATAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTGGAGTTGTATGCGAAGGATGAG
GATGCAATTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTCTGAACTGGGGTTCATGCCAAGTTCTTCACGCAGCAAGACAGTAGCGAATGGTGCCATATTGGCACAAGGTGCTGTT
GGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGC

Retrieve as FASTA