Entry information : EgrAPx[P]05 ( Eucgr.E00522 / Egrandis_v1_0.032468m)
Entry ID 8072
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-11 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EgrAPx[P]05 ( Eucgr.E00522 / Egrandis_v1_0.032468m)
Name (synonym) EgrAPx[P]05 ( Eucgr.E00522 / Egrandis_v1_0.032468m)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx[P]05
start..stop
S start..stop
EglAPx[P]06 247 8e-87 1..124 1..124
EguAPx[P]05 233 6e-81 1..132 1..132
EgrAPx[P]06 224 1e-77 1..132 1..132
EgrAPx[P]04 224 8e-77 1..117 40..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4950056..4950106 51 N° 2 4950193..4950272 80 N° 3 4950362..4950464 103 N° 4 4951045..4951206 162
join(4950056..4950106,4950193..4950272,4950362..4950464,4951045..4951206)


exon

Literature and cross-references EgrAPx[P]05 ( Eucgr.E00522 / Egrandis_v1_0.032468m)
DNA ref. Phytozome 11:   scaffold_5 (4950056..4951206)
Protein sequence: EgrAPx[P]05 ( Eucgr.E00522 / Egrandis_v1_0.032468m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   131
PWM (Da):   %s   13881.26 Transmb domain:   %s   i108-130o
PI (pH):   %s   4.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSDKDIVALSGAHTLGRAH*ERSGFDGPWTQEPLKFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYADEDAIFRDYAILHKKLSELGFTPSSSGSKTVANGAILAEGAVGVAVAAAVVILS

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (only 4 last exons with stop in it). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTGTTATTTT
TTTATTCTTGTGTCTAGGGAAGGGCACACTAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACTGG
ATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGATACAGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGC
ATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG
GTAAATAAGCTTTTCGAGTGGTCTGGTGACTCCATCGATAAATCTATAAAATTGAATTGCAGTTATATGGT
TTCCTTTTGTAAATTTGTTTTTGATGAAACTACCCCGCCCACACCACTATTTCGTTTCCTTATGCTCATGGTCTATAACCCTTTGATGCTACTGTCCTTGGTTTTGCCGAGAATGAAAAG
AGATGGAAAGTGTTTTTCATGGAATTTATGCTGTGTAGGCTTGTGATGCTTAAAAGTAAGCATTCAGTCTCTTCCATCACTATCTTCTATGTAGAGACCAGGAAATATTCATGATGAGAT
CGCACATCAAATGTTGGGTAGATACATACATGTGTTGGGATGGATATATTATGTGGTTCCCTGAAACCTCTAGGCTAGAGCATCATCTTTGTGCTACTGGGAACACCTGATTTGATATTT
GAATTGGTTGTTGTTCCCGCAACTCTCTCATGGTGGTTGGCACGACCTTGAAAAGAGACAAACGGACAATTTGATACCGTGCTTCTTTTCCTCCTCGTTTTCTTTTGCTATATGCTCTTC
TTTCCCTAATGTTGTCAAGCGTGTGGCAGGATGAGGATGCAATTTTCAGAGATTATGCAATCTTGCATAAGAAGCTCTCTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGACAG
TAGCGAATGGTGCCATATTGGCAGAAGGTGCTGTTGGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACTAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAGGATGAG
GATGCAATTTTCAGAGATTATGCAATCTTGCATAAGAAGCTCTCTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGACAGTAGCGAATGGTGCCATATTGGCAGAAGGTGCTGTT
GGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGC

Retrieve as FASTA