Entry information : EgrPrx78 (Eucgr.E02655 / Egrandis_v1_0.045402m)
Entry ID 8073
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx78 (Eucgr.E02655 / Egrandis_v1_0.045402m)
Name (synonym) EgrPrx78 (Eucgr.E02655 / Egrandis_v1_0.045402m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx78
start..stop
S start..stop
EcamPrx78 698 0 1..350 1..350
EgrPrx81 689 0 1..350 1..350
EguPrx78 684 0 1..350 1..350
EglPrx81 673 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42488169..42488441 273 N° 2 42487449..42487649 201 N° 3 42485818..42486396 579  
complement(join(42485818..42486396,42487449..42487649,42488169..42488441))


exon

Literature and cross-references EgrPrx78 (Eucgr.E02655 / Egrandis_v1_0.045402m)
DNA ref. Phytozome 12:   scaffold_5 (42488441..42485818)
Protein sequence: EgrPrx78 (Eucgr.E02655 / Egrandis_v1_0.045402m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (317)
PWM (Da):   %s   38139.45 (34673.7)  
PI (pH):   %s   9.55 (9.78) Peptide Signal:   %s   cut: 34 range:34-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPHLTSHSSPLTCSSTLFIALILICSQPNGSTAAAAANATGRHRQMSFDHYAKSCPQVEQLIGSVTSQQFKEAPVSGPATIRLFFHDCFVEGCDGSILISSKPGSKELAEKDAIDNKDLRAEGFETIAKAKSLVENKCPGVVSCADILAIAARDFVHLSGGPYYQVKKGRWDGRISKAARVPPNIPRANSTVDQLLKLFNSKGLTLADMVVLSGAHTIGFAHCVQFSSRLYNYKGTKRPDPVIDPRLLKALRMSCPQFGGNKDIVAPFDVTTPFLFDHTYYANLEAKLGLLASDQALFSDPRTRPVVQDMAKDKQKFFQAFGAAMEKMGMIGVKRGRKHGERRRDCSSHG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCATCTCACTTCTCATTCTTCCCCTCTAACTTGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACGGATCCACCGCAGCTGCCGCCGCCAATGCCACG
GGCCGCCACCGCCAGATGTCGTTCGACCACTACGCCAAGTCGTGCCCCCAGGTCGAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACC
ATCCGGCTCTTCTTCCATGACTGCTTCGTTGAG
GTAAAATCTCTCTCTCCTCTCTCTCTCTGCACTTACTTTCACTTGCATGCAATAGCAGCAGAGGAAGTCAATATTCAGGCAGATGCC
ACCAGCAGTTGAGCAACTCCCCACATTTTCAGCATCTTTTGTTAACTATGGTGACCGAATCCTTGCATATTCTTGTTTCTACACGAATGAGTCCGTGTACAACATCACTAATAAGAAATT
ACAGTTTTCATCAGCTAATCTTACCAAAAATTCAATTCAACCCTCCGGTGAGTGTTTCGTGTTTTGTTATTATTGCATTCCCCGAACCCGCCACAACTGTCAATCAAAGTCGGCCAGGCA
TGGGTCCCGAGTCGATAATTCTCTTCATTTTCATAGCAAGCGAGAGAAATTACCATGAAAAACACGGAGAATCATCAACTAGCGAGAAAATTACTGTTGGCAAACGCGGTTCATTTGTTA
ATCAATCTTAGTAGGGCAATAATCCTAGTGTAGAAACTACTGATTTTGCATAACTTATGACTGATGTGGAAGGGATGCGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAG
CTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACGATCGCGAAAGCCAAGTCCTTGGTGGAAAATAAATGCCCCGGCGTCGTTTCTTGTGCTGACATT
CTTGCCATTGCTGCCAGAGACTTTGTCCACTTG
GTACTTCCATCAACCTCTCGTCCTTAGTTATTTATTTATTTATTTATTCGTTTAACAAAGGGATTAACGGTGTGAAAATGTGATGAT
TTAGTCCAATCTAAAAGGACAATCAACTTCTCCGTAATAATTTTATTTTTAAATATTAATTTATTAAATTAGACATTACTTAGGATTTGAGAAAAATATAGTTGGCAATTTTTGTTGATA
ACGCAAAGCGCAAGGTTCATAATAGAACGTAGTCAAAGTGATATTTGATTAATATGAACCTAACTTTTGTCGTTATTAACGTAAAATTAGCTTTAACAGCCAAGACTTTGGTAATAGGTT
GTCGTCTTATTAACTTGGCTTTTCTGGCCAAGTTGGAGGGATCCAAAAGTTTGGCAGCAAGGCATCATTATAAAGACAAAAGGGTTTTTTTTTTTATTAATTTTTTTTAAAGCATCATAA
GGACAAGACCAATCAACTTAATGGCTTTTTGACAAGACCCATCACGTCCTGAACAAGACCTTAAACTGCTCCACAGGCCTGAGTGGGTGCAGACCCTGGGTACCTGTCGTCCTTAGCATG
ACATTAAATTGCGCAAGGGTATAACCAAGCCCACCGCCTTGACAGGCAATGAAGATAGAGGAGGAAAAGAACCCTCTAATGGGCCGAGCCAAAGCAGGTAAAATTGGTTGGTCCTAAGCA
AGATCTTAAAAGGCTTTGACAGCCTGAAAGCATATAGGCTAGAGAGTGGTTGTCCCCTCAATAAAAGACAACTCGCAAGCTTACCCGCCACATACTCCCTTCAGGAGGTAGGGAAGCCAC
CTTGGATCCAAGCAGGCTTCCTGGTGAAACATTTGGGCGCGCAGCGTGGGAAATGAAGGGGGTGCCCCGAAAGGGAAGCCATCAGAATCTTCTTTTTTTCCGATTTCTTTTTTATAATAA
TTTAAGCTTTAAAAAAAAAATAGAATTGCACATCATCTTTGATATAGAAGATTAATAGTTAGAGACGATGAGCATTAGTATAATGTGTGCATAGAAGATGATTTTTGATGTTGCTTGGAT
TGCAGTCCGGCGGTCCGTATTACCAAGTGAAGAAAGGGAGGTGGGACGGTAGGATCTCAAAGGCCGCGAGGGTGCCACCTAACATCCCTCGGGCAAACTCGACCGTCGACCAGCTCCTCA
AGCTCTTCAACTCCAAGGGCCTAACCCTAGCGGACATGGTGGTCCTCTCCGGTGCCCACACGATCGGGTTCGCGCACTGCGTGCAGTTCTCGAGCCGCCTCTACAACTACAAGGGCACGA
AGCGGCCCGACCCGGTGATCGACCCGAGGCTCCTGAAGGCCCTGAGGATGTCGTGCCCCCAATTTGGGGGGAACAAGGACATTGTCGCACCGTTCGACGTGACCACGCCATTTTTGTTTG
ACCACACGTATTACGCGAATCTCGAGGCCAAGTTGGGGCTGCTGGCCTCGGACCAGGCCTTGTTCTCGGACCCGAGGACGAGGCCGGTGGTGCAGGATATGGCGAAGGATAAGCAGAAGT
TCTTCCAAGCTTTTGGGGCTGCAATGGAGAAGATGGGGATGATTGGGGTCAAGAGGGGGAGGAAGCATGGGGAGAGGAGGAGAGATTGTAGTTCCCATGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCATCTCACTTCTCATTCTTCCCCTCTAACTTGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACGGATCCACCGCAGCTGCCGCCGCCAATGCCACG
GGCCGCCACCGCCAGATGTCGTTCGACCACTACGCCAAGTCGTGCCCCCAGGTCGAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACC
ATCCGGCTCTTCTTCCATGACTGCTTCGTTGAG
GGATGCGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGG
GCGGAGGGATTCGAGACGATCGCGAAAGCCAAGTCCTTGGTGGAAAATAAATGCCCCGGCGTCGTTTCTTGTGCTGACATTCTTGCCATTGCTGCCAGAGACTTTGTCCACTTG
TCCGGC
GGTCCGTATTACCAAGTGAAGAAAGGGAGGTGGGACGGTAGGATCTCAAAGGCCGCGAGGGTGCCACCTAACATCCCTCGGGCAAACTCGACCGTCGACCAGCTCCTCAAGCTCTTCAAC
TCCAAGGGCCTAACCCTAGCGGACATGGTGGTCCTCTCCGGTGCCCACACGATCGGGTTCGCGCACTGCGTGCAGTTCTCGAGCCGCCTCTACAACTACAAGGGCACGAAGCGGCCCGAC
CCGGTGATCGACCCGAGGCTCCTGAAGGCCCTGAGGATGTCGTGCCCCCAATTTGGGGGGAACAAGGACATTGTCGCACCGTTCGACGTGACCACGCCATTTTTGTTTGACCACACGTAT
TACGCGAATCTCGAGGCCAAGTTGGGGCTGCTGGCCTCGGACCAGGCCTTGTTCTCGGACCCGAGGACGAGGCCGGTGGTGCAGGATATGGCGAAGGATAAGCAGAAGTTCTTCCAAGCT
TTTGGGGCTGCAATGGAGAAGATGGGGATGATTGGGGTCAAGAGGGGGAGGAAGCATGGGGAGAGGAGGAGAGATTGTAGTTCCCATGGGTGA

Retrieve as FASTA