Entry information : EgrPrx87 (Eucgr.E04120 / Egrandis_v1_0.016738m)
Entry ID 8074
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-16 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx87 (Eucgr.E04120 / Egrandis_v1_0.016738m)
Name (synonym) EgrPrx87 (Eucgr.E04120 / Egrandis_v1_0.016738m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx87
start..stop
S start..stop
EglPrx87 667 0 1..327 1..327
EguPrx83 655 0 1..327 1..327
EcamPrx87 652 0 1..327 1..327
EgrPrx83 643 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 70616272..70616496 225 N° 2 70616897..70617082 186 N° 3 70617360..70617525 166 N° 4 70617707..70618113 407
join(70616272..70616496,70616897..70617082,70617360..70617525,70617707..70618113 )


exon

Literature and cross-references EgrPrx87 (Eucgr.E04120 / Egrandis_v1_0.016738m)
DNA ref. Phytozome 12:   scaffold_5 (70616272..70618113)
Protein sequence: EgrPrx87 (Eucgr.E04120 / Egrandis_v1_0.016738m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35120.09 (32079.5)  
PI (pH):   %s   8.09 (8.20) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSKLFLSCLLVQLTLLFLVPEVAHGQGLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTNQSEKNAGPNLSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGALSYDVETGRRDGNVSILTDALNNLIPPTANITTLKADFAKKGLSVKDLVALSGGHTIGTSHCSSFSDRVYNFTGKGDADPTLDSNYIARLKLRCKPNDQTTLVEMDPGSVRTFDVKYFDLIPKRRGLFTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTATTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AATGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCG
AGCTCACATGATTCTCGTCCTACCACAAGTGTAACTCGTCCTACTACGAGTGTAAAGTTTACCATTTTCTAATTACGTGATTCTTTGCATGTAACTAATGTTCGGATTCTAAGGTGAAAA
ACTTACTGGCGAAAAACGAGCGTGAGAATTTAGATCTTGGGCTTTCATCTGAAGGGGTAATGCATGGTAGGAATGCATAGAGATTTACAAAATTGATTTACTAGATAACAATATGATAAA
ATGGAAAATGTGTATTAGAACTAGTTATGTACTAGTAAATGGTGTTTGGCTCTTCAGCATACTTCTCTAGATTCGTCCTTGCTTACGAACTACTGTCTTCATGAACTCACGGTTGAATCA
TCTTTTGTTCTGGGCCTCTCCACAGGGCTGCGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGA
TAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATCGTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
GTGAGCATATGCATACATTACCTCCTTTA
TTGTTTGTTTTAAACTTGGATTTTTGTTATATAATTAGGACGTTAGTAGAAATCTTGATTTCACAAACGATATGTGTTATCTCATTTGAAAACAAATTCTAGCCATACATATTATGGAAT
CCAAGTATCGTTTGTTGATATTAAGATTATTTTTACGGCGCTCTTGACAAAACACGACTATTTTGTATTTTAATGAGAAAAACATTCTTATATAGATTTTTTTTTTTTTTTTTGGCGTTG
TCTTTTAGACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCTTGACCGACGCACTTAACAATTTAATACCACCTACGGCCAACATTACAACTCTGA
AAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGCCCTGTCAG
GTAACCCCTAATCTCCAATTATTGCTCCATATGCTTTGTCAATTATTTTATGGGGATTGACATAAA
TTAATCGGGAAGAAATTGTAATTCGAGTGCGATATCATAAACATCGTCAGCACTACAACGAGAGAACATAATTTGTGTAATTAGATCATGCTAATTCTGATTTCCAATTGACCAGGTGGG
CACACCATTGGAACTTCACACTGCTCTTCCTTCTCCGACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGC
AAGCCGAATGATCAAACCACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTT
CTTGATGACAGCGAAACCAAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGA
ACGGCGGGCGAAGTCAGAAAAGTGTGCACAAAGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTATTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AATGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GGCTGCGAAGGTTCG
GTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATC
GTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
ACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCTTGACCGACGCA
CTTAACAATTTAATACCACCTACGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGCCCTGTCAG
GTGGGCACACCATTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAATGATCAAACC
ACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGACAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGCGAAGTCAGA
AAAGTGTGCACAAAGGTCAATTAA

Retrieve as FASTA