Entry information : EgrAPx-R (Eucgr.C01740 / Egrandis_v1_0.016593m)
Entry ID 8079
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-07-28 (Catherine Mathe)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-06-19 (Qiang Li)
Peroxidase information: EgrAPx-R (Eucgr.C01740 / Egrandis_v1_0.016593m)
Name (synonym) EgrAPx-R (Eucgr.C01740 / Egrandis_v1_0.016593m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx-R
start..stop
S start..stop
EguAPx-R 692 0 1..342 1..342
EglAPx-R 691 0 1..342 1..342
EcamAPx-R 669 0 1..342 1..341
CsAPx-R 451 9e-161 16..342 10..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29587959..29588190 232 N° 2 29588272..29588353 82 N° 3 29588964..29589091 128 N° 4 29589622..29589692 71
N° 5 29589875..29589917 43 N° 6 29589994..29590090 97 N° 7 29590261..29590344 84 N° 8 29590903..29591024 122
N° 9 29591385..29591451 67 N° 10 29591899..29592001 103  
join(29587959..29588190,29588272..29588353,29588964..29589091,29589622..29589692 ,29589875..29589917,29589994..29590090,29590261..29590344,29590903..29591024,295 91385..29591451,29591899..29592001)


exon

Literature and cross-references EgrAPx-R (Eucgr.C01740 / Egrandis_v1_0.016593m)
DNA ref. Phytozome 12:   scaffold_3 (29587959..29592001)
Protein sequence: EgrAPx-R (Eucgr.C01740 / Egrandis_v1_0.016593m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343
PWM (Da):   %s   36512.48  
PI (pH):   %s   7.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSPSTTHLSPLTCCSSSSSLSSHPSSRRTKFEFPANSQRSSPSPIASRAGAIASPSSSTPGAASSGDHAPVRGRSVAGLAATLPFLLQLRGYTEGIVADAAELDNDEYTMIKEEVRKVVSKVKAAGVLRLVFHDAGTFEMGENSGGMNGSIVYELERPENAGLKKPVKILEKAKGEVDAKRPVSWADMIAVAGAEAVSVCGGPTIPVVLGRLDSMKPDPEGRLPEETLDALGLKQCFQRKGLSTQELVALSGAHTLGSKGFGNPVVFDNSYYKVLLEKPWMSSAGMPSMIGLPSDRALVEDNECLRWIEKYANDQNLFFKDFENAYVKLVNSGARWRSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Egrandis_v1_0.016593m where intron in PS is not predicted!!!. No EST. One other alternative transcript: Egrandis_v1_0.018459m (low identity for the PS when compared with PtAPx-R).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCC
CAACGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGCCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
GTTTCGCG
AATCCGGTCGATCGCGATCTTTCGGAGCTCGCAGCTGGAGACCGCGTCTCGAGGAGGAGGAGGAAGCTCATAGCCGTGGCGGGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGC
GGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
GTAAGCTCGACGCTCTTTGCTTGACGAAAGTCCATGTCTTTATTGGTTGGAACGAATGAAACGGGAATTTCGAGGGAGATTGAGA
TGCTTTTGAGCTTTGGAGTTGAGCCTGCGGAGCGAAAGAAGGCTATGCGTTTTCGTCGGTGGTCGGATTATGGGTTTTGCAGCTGCTTCTTCCGGTGATCAGTTTGTGTGTATGTGTGCA
TGCTACGGAGTTGTCCCGCCGAAATGACGCTTTTTGCTTCCTTTAAAGGACTTACTTGCCGTTTAAAGTAGGAGGTCCAGGTGTGGTCCTTCGGATTATGAGATTTTAGTTTGTGTTTCC
GGCTTGCTCATTCACTGACTTCCTGGATTTTAGTATCTGTAAGCTGTAACTGTGAAGTGTCTTGTTTCTCAACATTGATGTTATGGACACCGCATTCAGCTGGGGAAAAACCATTTTGGG
TGATGGTTTGATGGGTCGAAATTGCGATTCGGAAGTACTAATTGGATAGGGCTGTGAGTTTGATATTTTGTTTATCGTGACCTTGGGGCTGCATCTGTATTTGTGTTGACTTGGGGCATT
TGGATATGTCCATGACTGTTGGTTTTTCATGTTCGTATATCAAAGATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAGGTAGTTTCCAAGGTGAAGGCTGCTGGTGT
GCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTATTTTACATGGACAGAAAGTTAAAGTTCTACAAATAATGATACTCGACATCAGTAACTGTGCTCC
ATATCTCTGGCTACAATTTTTGAATGCCTACTAATCGATCCAAATTGTTTTATCCTCTTTTCCCCATAATTGAACTTTTGAGCTGAAGCTAAGATGATGCATATATTGATTTCATCTGAA
TTAGGGGGATATAGCTCTCATTTGCCAAAAAAGTTAGATAATCCTTGTAAATGGGCATAACTTTTTTTTGTCATGGTGGTTTACTAAATGAACAAGGGCAAGTAATTCTATGACTGTTAA
AGCAACTACAGACTCTAATGGACCTTTATAAATGAATGATCAATCATGGAGAGCAGTATCATTCATACTACCTGTATTTGTGAACTAATGGTCATGTCCGATTCTTTTAATGCATGCACA
TACTTCTTTTGAGTTGAAAATTTTCTGCGTCGTGCTTTTTTGTCTGAGTATGGATTTCAATCCTCATATTGTAATTCTAATATGTTTTTGTGTCAATATCCAGGTGGTATGAATGGTTCC
ATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAG
GTATGTTTTCTTTTATTACATCCTCAAGCTTAGCATCCATTCTGGAGATGCAACATTTCATTTCAA
CTGGTGTACTCCCTCATGCATTTCTGGACTGCTAGAAGTTCCTGTATCTTATGTCTAGAACAGTCAACTCCGGTTCATCTTCAGGCTAACTCGTCAGTCATTGTGTTGTTGTTTAGATAC
TAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAG
GTGATTTTTTTGAGTGTTATATTCTATATGCTGATGGTATGATTGTGGTGATATAGATGGAACTTTCCTCTCTCAGTATCC
TGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCTGTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GTAAGAAGCTATTTCCAATTCAATTACT
ACTGTTCTGAAGATGCGTTGATGGCAGACAAAACATTATTTCACTCATTTAGTATTGTCAGTATTGCAAGATTCTTTGCATGTCTCCATCTTTGTGCATAGTCCCAAGCTAATATTGGTT
TGGTTTCATTTCTTTATTGAAGGAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAAAGCAGTGTTTTCAGAGGAAGGGCTTATCGTGAGTTGCTATCC
CATGTACATGTCGAATGATGCTTGCAAATTAAATGAAGTATTGTTTATTGACTATTGCATATTGTTATGCATCTTACTGCTGATGGTTAAACTGTTTAATAGATATTTCACCGGTCAACA
TAGAATTGGTTGTTTAGTCAACTGTGATACGTTATGTTTTGCAATTTCAGGATGATAGATTCAGAGCCGCCACAACTGAGGGGAAACTTTGGGACAGCCTTTGCTAAAACACACACACAA
AACAACCCCAAAAAAGCAAGACAACTATGCTTCCTTCTGTGGCAATAAGCATTCCTTCTTTGTTTTTCCCCTCCATTCCAAAAAAATTATGCCCCCTCTATGAGTTATTATTCTGACAGT
ATTAGCTGCATGATTACAAAAATGAAGCTTTCGAAACAGACTAAGAACATGTTTGATTGTTCCTGCTATGGACTCTGTTTGATTTTTTTTTGCTATAGAAATCTGTCCTTTCAGTTTCTT
ACACTATTCTGTAGTTTCTTCTCTCAGCAAAAGGAACATATTGATGTTGTCCTCATCCTCTCAGGACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTG
GGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAACCCTGGATGTCTTCAG
GTAGCGAAAAAACATTGATGGTTCTCATGTTCTTCTGTTAGACTTTTTGCCGGA
CGTAGTTACGTTGGCCTACTGGTTCTAGTTTGTTGTAGGTAAAGCATTATTTGGCATGAAATTAGTCCTGCCATCAGCTTTCTAACCCAGGAAAAGATTCTATATCTGATACTATGGAGT
CATAATTGTGGTATTGTTTCAATAGTTAGCTCTGATGCAGTGGAAATTTATTTAGTCTGTACTGGGAAAAGGTTATTCTCACTTTTTCTGTTGCAAAAGCGACCTGAGTTTTTCTCATCG
GTAATAGTTCTCACTTAAGCTTTGCTCTTAATTATCCCTTGCTTAATTTCCTTTTTCTCAATGCAGCTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACA
ATGAATGCTTAAG
GTTACTGATTTGATATCCCTACTATTTCCTTTTTACTAGGAAGATGGGAACAGTTTAGCCATATCTTTCTGGCCATAGACTATTATGGTGAGATATATATATATCGC
TGTCACTGGCACTTGTCAACTTTCAGGGATGCACCATTATTGCCACTTTTGATTTTCTTTTTCTCATGATTCTGGATAAAAGTTGGCTTTTGTCTTAATGATCCAGTTAAATCCACATTC
CATAAATATGGGAGGTGCTATATTATCATGGCCTGTTTATGCTTCTGAGAAAGCAATGTAGAATGGAAATGTGCCGACACAACAAACATAAGTAGCCAGTCTGAAGTAATTAGTATCACC
TGATTTACTATGGATATTTTGCATGAGAATGTTCTGTTTAATGTGATATTTGTTTCTTTTATTTGCTCGATCATGATACCTATATATTTTATATATACAGATGGATTGAGAAATATGCAA
ATGATCAGAATTTGTTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCC
CAACGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGCCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
CCGTGGCG
GGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCGGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
ATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAG
GTAGTTTCCAAGGTGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGG
CCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAG
ATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTT
TCTGTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAAAGCAGTGTTTT
CAGAGGAAGGGCTTATC
GACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTGGGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAG
AAACCCTGGATGTCTTCAG
CTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACAATGAATGCTTAAGATGGATTGAGAAATATGCAAATGATCAGAATTTG
TTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTGTGA

Retrieve as FASTA