Entry information : EgrAPx-R[P] ( Eucgr.C01738 / Egrandis_v1_0.037241m)
Entry ID 8086
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-14 (Christophe Dunand)
Peroxidase information: EgrAPx-R[P] ( Eucgr.C01738 / Egrandis_v1_0.037241m)
Name (synonym) EgrAPx-R[P] ( Eucgr.C01738 / Egrandis_v1_0.037241m)
Class Ascorbate peroxidase related    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx-R[P]
start..stop
S start..stop
EguAPx-R[P] 119 1e-37 1..60 1..60
EguAPx-R 120 3e-35 1..60 113..172
EglAPx-R 120 4e-35 1..60 113..172
EgrAPx-R 119 4e-35 1..60 113..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29572460..29572565 106 N° 2 29573092..29573198 107  
join(29572460..29572565,29573092..29573198)


exon

Literature and cross-references EgrAPx-R[P] ( Eucgr.C01738 / Egrandis_v1_0.037241m)
DNA ref. Phytozome 12:   scaffold_3 (29572460..29573198)
Protein sequence: EgrAPx-R[P] ( Eucgr.C01738 / Egrandis_v1_0.037241m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   70
PWM (Da):   %s   7635.08  
PI (pH):   %s   9.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIKEEVRKVVSKVKAAGVLRLVFHDAGTFEMSENSGGMNGSIVYELERPENAGLKKPVKVCFLLLLHPQA

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (Fragment, two exons only one predicted by phytozome). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAAAGGAAGAGGTCAGAAAGGTAGTTTCCAAGGTGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGAGTGAAAATTCAGGGATTTTACATGGA
CAGAAAGTTAAAGTACTACAAATAACGATACTCGACATCAGTAACTGTGCTCCATATCTCTGGCTACAAGTTTTGAATGCCTACTAATCGATCCAAATTGTTTTATCCTCTTTTCCCCAT
AATTGAACTTTTGAGCTGAAGCTAAGATGATGCATATATTGATTTCATCTGAATTAGGGGGGTATTGCTCTCATTTGCCAAAAAAGTTAGATAATCCCTGTAAATGGGCATAACTTTTTT
TTTGTCATGGTGGTTAACTAAATGAACAAGGGCGAGTAATTCTATGACTGTCAAAGCAACTACAGACTCTAATGGACCTTATAAGTGAATGATCGATCATAGAGAGCAGTATCATTCATA
CTACCTGTATATGTGAACGGTCATGTCCGATTCTTTTAATGCATGCACATACTTCTTTTGAGTTGAAATTTTTCTGCGTCATGTCCTTTTGTCTGAGTATGGATTTCAATCCTCACATTG
TAATTCTAATATGTTTTTGTGTCAATATCCAGGTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAGGTATGTTTTCTTTTATT
GTTACATCCTCAAGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAAAGGAAGAGGTCAGAAAGGTAGTTTCCAAGGTGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGAGTGAAAATTCAGGTGGTATGAATGGT
TCCATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAGGTATGTTTTCTTTTATTGTTACATCCTCAAGCTTAG

Retrieve as FASTA