Entry information : SbPrx105 (Sobic.008G010500.1 [2.1] / Sb08g000990 [1.4])
Entry ID 809
Creation 2005-06-14 (Christophe Dunand)
Last sequence changes 2005-06-14 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx105 (Sobic.008G010500.1 [2.1] / Sb08g000990 [1.4])
Name (synonym) SbPrx105 (Sobic.008G010500.1 [2.1] / Sb08g000990 [1.4])
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx105
start..stop
S start..stop
SiPrx111 586 0 14..328 17..331
SbPrx83 571 0 28..328 31..331
SiPrx54 565 0 28..328 21..321
SiPrx112 564 0 29..328 22..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 922312..922740 429 N° 2 922867..923032 166 N° 3 923388..923779 392  
join(922312..922740,922867..923032,923388..923779)


exon

Literature and cross-references SbPrx105 (Sobic.008G010500.1 [2.1] / Sb08g000990 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_8 (922312..923779)
Protein sequence: SbPrx105 (Sobic.008G010500.1 [2.1] / Sb08g000990 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (296)
PWM (Da):   %s   34594.27 (31675.6) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.94 (7.68) Peptide Signal:   %s   cut: 33 range:33-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPSAPSGGRSGVIAVLLLLVLLAGTGTSSAQLCTSFYSHSCPGVYDAVRSVLQAAIAREQRMGASILRLFFHDCFVQGCDASLLLDDTPSFQGEKMANPNNGSARGFEVIDAIKSAVDKVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSRTASFSGANNNIPPPTSGLVNLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHIYNDTNIDGSFARSRQSVCPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVYKKGILHSDQELFNGGSTDAQVQSYVSSQSAFFADFVTGMIKMGDIMPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 2 and 3) and 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCCATCAGCCCCGAGCGGCGGCAGATCAGGCGTCATCGCTGTCCTCTTGCTTCTTGTGTTGCTGGCCGGCACCGGCACCTCGTCGGCGCAGCTGTGCACCAGCTTCTACTCC
CACTCGTGTCCCGGCGTGTACGACGCCGTCAGGTCGGTGTTGCAGGCCGCCATCGCCAGGGAGCAGCGCATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAGGGC
TGCGACGCCTCGCTGCTGCTGGATGACACGCCCAGTTTCCAGGGCGAGAAGATGGCCAACCCCAACAACGGCTCCGCCAGAGGATTCGAGGTCATCGACGCCATCAAGTCCGCCGTCGAC
AAGGTCTGTCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCCATCGCCGCAAGAGACAGCGTCGTCATC
GTAAGCCTACTAGCTAGCCGCCCTTGTAGTATATATTCTTAATTTGAATCA
CTTTCAGAGCTAGAAAGATGCATGAGACTGAACCTGCAACTGATGGATGCATTGCATGCACACTGACACATGCAGCTGGGTGGTCCGAGCTGGGACGTCAAGGTCGGGAGGAGGGACTCG
AGGACGGCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCGACGTCGGGCCTCGTCAACCTCACCTCGCTCTTCGCCGCGCAAGGCCTCTCCCAAAAGGACATGGTCGCGCTATCT
G
GTGCGTATTTTATTATACAATATTCCCACTACGACAGTACGTGGTAATTAACTACTAGCTGTAAATAAATGCAATGCTAAATCTCCAAGAAAACTTTGTCTCTCATTTTTTTTTTCGAA
GAACTTTGTCTCTCAACTTAATTTGGAGATATAATTCTCCACACTGTTTCTCAACCACTAGCTCAACATAGATATTTGGGAGATAAGTTTATGTGCTAGATTAAATTAAGTGGTATAGTA
TAGATCATTCATTTCCTCCACTCCATTTTGTAACTTTGTACGTATCATGTTCAATTCGCTCCAAATCTAAGTCACTAAATATTTTCATGTATGTGTCGCTTTGCCTCTTTTGCCAGGAGC
CCACACCATTGGCTTAGCACGCTGCACCAACTTCAGAGCCCACATATACAATGACACCAACATCGACGGCAGCTTCGCAAGATCAAGGCAATCGGTTTGCCCTAGGACCTCAGGTTCAGG
TGACAATAATTTGGCGCCTCTAGACCTTCAAACCCCAACTGTCTTTGAGAACAACTACTACAAGAACCTTGTTTACAAGAAGGGGATTCTACACTCTGACCAAGAGCTCTTCAATGGTGG
ATCAACCGATGCGCAAGTCCAATCATACGTTAGTAGCCAGAGCGCGTTCTTTGCGGACTTTGTGACTGGCATGATCAAAATGGGTGACATCATGCCATTGACCGGCTCCAACGGGGAGAT
CAGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCCATCAGCCCCGAGCGGCGGCAGATCAGGCGTCATCGCTGTCCTCTTGCTTCTTGTGTTGCTGGCCGGCACCGGCACCTCGTCGGCGCAGCTGTGCACCAGCTTCTACTCC
CACTCGTGTCCCGGCGTGTACGACGCCGTCAGGTCGGTGTTGCAGGCCGCCATCGCCAGGGAGCAGCGCATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAGGGC
TGCGACGCCTCGCTGCTGCTGGATGACACGCCCAGTTTCCAGGGCGAGAAGATGGCCAACCCCAACAACGGCTCCGCCAGAGGATTCGAGGTCATCGACGCCATCAAGTCCGCCGTCGAC
AAGGTCTGTCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCCATCGCCGCAAGAGACAGCGTCGTCATC
CTGGGTGGTCCGAGCTGGGACGTCAAGGTCGGGAGGAGGGACTCGAGGACG
GCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCGACGTCGGGCCTCGTCAACCTCACCTCGCTCTTCGCCGCGCAAGGCCTCTCCCAAAAGGACATGGTCGCGCTATCTG
GAGCC
CACACCATTGGCTTAGCACGCTGCACCAACTTCAGAGCCCACATATACAATGACACCAACATCGACGGCAGCTTCGCAAGATCAAGGCAATCGGTTTGCCCTAGGACCTCAGGTTCAGGT
GACAATAATTTGGCGCCTCTAGACCTTCAAACCCCAACTGTCTTTGAGAACAACTACTACAAGAACCTTGTTTACAAGAAGGGGATTCTACACTCTGACCAAGAGCTCTTCAATGGTGGA
TCAACCGATGCGCAAGTCCAATCATACGTTAGTAGCCAGAGCGCGTTCTTTGCGGACTTTGTGACTGGCATGATCAAAATGGGTGACATCATGCCATTGACCGGCTCCAACGGGGAGATC
AGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA