Entry information : EgrPrx[P]07
Entry ID 8090
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EgrPrx[P]07
Name EgrPrx[P]07
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]07
start..stop
S start..stop
EguPrx05 380 2e-134 6..274 1..274
EglPrx[P]07 374 3e-133 33..274 1..226
EglPrx02 316 5e-109 25..274 13..311
EcamPrx[P]07 273 2e-94 140..274 14..148
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 442761..443024 264 N° 2 442397..442547 151 N° 3 440606..441012 407  
complement(join(440606..441012,442397..442547,442761..443024))


exon

Literature and cross-references EgrPrx[P]07
DNA ref. Phytozome 12:   scaffold_1 (443024..440606)
Protein sequence: EgrPrx[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   272 (245)
PWM (Da):   %s   30831.41 (27849.7) Transmb domain:   %s   i9-31o
PI (pH):   %s   9.01 (8.45) Peptide Signal:   %s   cut: 28 range:28-272
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
EKRKKLRASSWWLLLSLAALALVSSCAVRHVEVAVGIETPQKLQWHYYRNSCCDAERYVRTQVEFYWKLDRSLAPKLIRMLYANYFVMGCDA*ILWDGPYSEKTAPQNVELLGFPMAVMDKIKQVLEQHCLGVVS*ADWHSMGKTNCSFIADRLYNFNKTGKPDPSMDSSFLALTRKQCPPNSKNQVYLDPDSGSNYSFSKSFYSRVLNHRAVLSIDQQIAANNDSSQIAEEYNASFEDFRKMLALSMSQMGNIKVLTGKQGEIRKNCRVVNG

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, stops in frame, PS is missing). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAAAACGAAAGAAATTGAGAGCGTCAAGTTGGTGGTTGTTGTTGTCGCTGGCCGCGCTTGCGTTGGTGAGCTCGTGTGCCGTGCGGCATGTCGAAGTGGCAGTGGGGATCGAGACGCCA
CAGAAGCTGCAGTGGCATTACTACCGGAACTCATGCTGCGACGCCGAGAGGTACGTTAGGACCCAGGTCGAGTTCTACTGGAAGCTGGACAGAAGCCTCGCGCCCAAGCTCATCCGAATG
CTCTATGCCAACTACTTCGTCATG
GTACATTTCTGTCCTTTCTTATCCTCTGTCGAGCGATCTATCAGTCCGCATCACTTCAATATCAAGTTTCCATCGCCCTTCTAAGCACGTGATATC
CTTTCACCCAATGGTTTAACCTCTTGAACCGGGCTTTCTTACATAACACTCTTGTGTACATATATACATCAAACAAAGCCTTGGACTCAGATATGTTTGGTTATGTATACAAAACAGGGG
TGCGACGCGTAGATTCTATGGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAATGTAGAGCTTCTAGGGTTTCCTATGGCGGTGATGGACAAGATCAAGCAAGTCCTGGAACAACAT
TGTCTAGGAGTCGTCTCTTGAGCTGACT
GTTAAATTATGACTCAAGCTTAAGCATTTGGAAAAACGCGATTTGCTGGACTCCTTAAAGCTGCACAAAAGGAGGAAATAATTAAAAAGAGG
AATTTTGCCCTTCGGAGTGAAGCCACCGAAATTTCTCTTTTCCTTCAAGGGACGTCGCTGTAGCTCTACGTAGAAGAAGCGAAGGAAGAAGCCCTGCACATGAAGATTTGTTAAAGTGGT
GGGTTCAAGGTCAAAAGTTTGATCTTGGGCACACACGCACACTCAATATTACAGAATGGGCTGATGGATAAATAAAAAGGGGAAGCTCTCTCATGTACGCGTGAATCCAACGTTGGTGGG
CCCAGGTCAGCTATTTGACCATAGGCACACGATTTCCTTCTTTGGCGTGCGCGTGAAGTCAGTTTAAAAGAAAAGAGAACCCTACATATGCGTTGGGCAAAGCCACGTATTGAAGCGCCG
TTTACTTTGAGTGTCGTGGGTGATACGTTTGTAGAGGCTGGAGGTCTTCGTATTTCTCGTGTAGAAAAGCTTATTCGTAATTTACATCTAAGAAAGATTGGTGTATTGGGTGTAATTGGG
GTTTGGGAAACACCGAAAGAATATTTGAGTGAATCGAGTATGTAATCTCATTGTATTGCTTGATTTATAGTGAAATTCGCTGCTGTTCTTCCCGTGAACGTAAATCTTTACGATTAAACC
ACATAAATCTAGTATTCAATTTATTTTCTTTTCTGTCTATATTATTGTTCGATCGCTCGCTTAATTGCAATACTAACATACTTAACTTTGCTGCTAGAGATGCTACTCACTTGGTATGTA
CCTGGTTTGCAGTTCTCTCTTTTGGCTTGAAAAGACGTTTTCGCGCACTGGTTATTGACATACTGTTAGCTTGAGCTTGTAGCGTTAGATGTGGAAAATTAGCATTGCTGATGTGATAAT
AATGCTGAAATAGGCGGGAGGGCTATCGTACCCTGTTCTAGCAGGGAGGAGGATGGGATGTCGTCCTCCGCGGCATCGGTGGACCCCACGTTGGGGGCCACCCCTTGGGAATTGCCGCTC
GCTAACTTCGAATGAATAGGTTTGGATGTGCTGGACCTTACTACTCTACTCGGTACAATTGAACCTCATATGAAAAGGTATTTAACTTGTGACCTCGTTAAATTACATTATATCTCAAGC
AATCCTTTTCGATTTTAATTTTTTGAAATCTCCATCTAATTGTCAGGATACATAGAATTTTATCAGATATAGGATAGTCGAGAATATAATCCGAACCGATCCTCCCAATGATTACCTCCA
AGTGCACGAAACGACATGTTTATGTACTATGTCAAATATCAAAATCAGAACCAATTCCTAACTTGCCAAAACAATGTAAATTTAGCCAGGAGGGCATTCAATGGGCAAGACCAACTGCAG
CTTCATCGCGGACCGGCTGTACAATTTCAACAAAACTGGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTGGCCCTGACGAGGAAGCAATGCCCACCGAACTCTAAGAACCAAGTGTA
CCTTGACCCTGATTCAGGCTCCAACTACAGCTTCAGCAAGTCATTCTACTCCAGGGTCCTGAACCACCGTGCCGTCCTCAGCATCGACCAGCAGATCGCTGCCAACAACGACAGCTCCCA
GATCGCTGAGGAGTACAATGCCAGTTTTGAGGACTTCCGGAAGATGTTGGCCCTATCGATGAGCCAGATGGGGAACATCAAGGTCTTGACGGGGAAGCAGGGGGAGATTCGCAAGAATTG
CCGAGTCGTGAACGGGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAAAACGAAAGAAATTGAGAGCGTCAAGTTGGTGGTTGTTGTTGTCGCTGGCCGCGCTTGCGTTGGTGAGCTCGTGTGCCGTGCGGCATGTCGAAGTGGCAGTGGGGATCGAGACGCCA
CAGAAGCTGCAGTGGCATTACTACCGGAACTCATGCTGCGACGCCGAGAGGTACGTTAGGACCCAGGTCGAGTTCTACTGGAAGCTGGACAGAAGCCTCGCGCCCAAGCTCATCCGAATG
CTCTATGCCAACTACTTCGTCATG
GGGTGCGACGCGTAGATTCTATGGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAATGTAGAGCTTCTAGGGTTTCCTATGGCGGTGATGGAC
AAGATCAAGCAAGTCCTGGAACAACATTGTCTAGGAGTCGTCTCTTGAGCTGACT
GGCATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAACT
GGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTGGCCCTGACGAGGAAGCAATGCCCACCGAACTCTAAGAACCAAGTGTACCTTGACCCTGATTCAGGCTCCAACTACAGCTTCAGC
AAGTCATTCTACTCCAGGGTCCTGAACCACCGTGCCGTCCTCAGCATCGACCAGCAGATCGCTGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTTGAGGACTTC
CGGAAGATGTTGGCCCTATCGATGAGCCAGATGGGGAACATCAAGGTCTTGACGGGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAG

Retrieve as FASTA