Entry information : EgrPrx08 (Eucgr.A00045 / Egrandis_v1_0.039923m)
Entry ID 8092
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx08 (Eucgr.A00045 / Egrandis_v1_0.039923m)
Name (synonym) EgrPrx08 (Eucgr.A00045 / Egrandis_v1_0.039923m)
Class Class III peroxidase    [Orthogroup: Prx123]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx08
start..stop
S start..stop
EglPrx08 593 0 1..337 1..338
EguPrx08 584 0 1..337 1..337
EguPrx09 569 0 23..337 15..327
EgrPrx09 556 0 1..337 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 446064..446312 249 N° 2 445714..445899 186 N° 3 445434..445598 165 N° 4 444803..445216 414
complement(join(444803..445216,445434..445598,445714..445899,446064..446312))


exon

Literature and cross-references EgrPrx08 (Eucgr.A00045 / Egrandis_v1_0.039923m)
DNA ref. Phytozome 11:   scaffold_1 (446312..444803)
Protein sequence: EgrPrx08 (Eucgr.A00045 / Egrandis_v1_0.039923m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (317)
PWM (Da):   %s   37257.65 (34788.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.6 (8.13) Peptide Signal:   %s   cut: 21 range:21-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWWLLLLLAFVVLVSSCAMLRVEAAVGIEPPQKLQWHYYRNSCRDAERYVTSQVEFYWKRDKSLAPKLIRMLYADCFVTGCDASILLDGPYSEKTAPQSAGFLGFPMVVIDKIKQILEERCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRRDGMSSSAASVDLPLGAALWGSALAYFESRGLDVLDLTTLLGTGGHSMGKANCSFIADRLYNFNKTGKPDPSMDSSFLAQMREQCPPNSKNQVYLDPDSGSSYSFSKSFYSRVLNHRAVLGIDQQIGANNDSSQIAQQYDGSFEDFRKRFALSMSRMGNIKVLTGNQGEIRKNCRVVNRK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YADC'. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGTTCGTTGTGTTGGTGAGCTCGTGTGCCATGCTGCGTGTCGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCGTGCCGTGACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GTACGGATCTGTCTGTTCTTATCCTCTCTTGAACGATCTTTCAGTCTGCATCGCTTCAATATCGAGTTTCCATCGCCTCTCTAAGCACACAATATCCTCTCACCCAACGTT
TTAAGCTCTCGAAACGGGCTTTCTGACGTACCGATCTTTTGTGTATAAAACAGGGGTGCGATGCGTCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGT
TTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATCCTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
G
TATGTGCCTGGTTTGCACTTCTCTCTTTTGGCTTGAAAAAGTTGTTTTCGCTTGAGTTTATAGCGTTAAATGCGGAAAATAAGAATTACTCATACAATGATAATGTTGTCATAGGCGGGA
GGGCCATCGTACCCCGTTCTGGCAGGGAGGAGGGACGGGATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGA
GGCTTGGATGTGCTGGACCTTACTACTCTGCTTGGTACG
GTCGAACCTCGTATGAAAAGTATTTATTTGACCTGGACCTCATTAAATTACCTTAGATCTTAAGCAATCCGGGCAACTTGT
TTAGTCTAGTGCGGTTGAGAGGAAAAACGAAAATCATGATGTTCTTTTTTGATTTTAAGTTTTCAAAATCGTTGTCTAATTGTCATGATACGAAGAACCAATTCCTAACTTGCCAAAACA
ATTTAAATTTTGCCAGGGGGGGCATTCAATGGGCAAGGCCAACTGCAGCTTCATCGCGGACCGGCTATACAATTTCAACAAAACTGGCAAGCCGGACCCAAGCATGGACTCATCCTTCCT
GGCCCAGATGAGGGAGCAATGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGC
CGTCCTCGGCATCGACCAGCAGATCGGCGCCAATAACGACAGCTCCCAGATCGCTCAGCAGTATGATGGCAGTTTCGAGGACTTCCGAAAGAGGTTCGCGCTGTCAATGAGCCGGATGGG
GAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGTTCGTTGTGTTGGTGAGCTCGTGTGCCATGCTGCGTGTCGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCGTGCCGTGACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GGGTGCGATGCGTCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGTTTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATC
CTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GCGGGAGGGCCATCGTACCCCGTTCTGGCAGGGAGGAGGGACGGG
ATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGAGGCTTGGATGTGCTGGACCTTACTACTCTGCTTGGTACG
GGGGGGCATTCAATGGGCAAGGCCAACTGCAGCTTCATCGCGGACCGGCTATACAATTTCAACAAAACTGGCAAGCCGGACCCAAGCATGGACTCATCCTTCCTGGCCCAGATGAGGGAG
CAATGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGAC
CAGCAGATCGGCGCCAATAACGACAGCTCCCAGATCGCTCAGCAGTATGATGGCAGTTTCGAGGACTTCCGAAAGAGGTTCGCGCTGTCAATGAGCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA