Entry information : EgrPrx45 (Eucgr.A01385 / Egrandis_v1_0.019593m)
Entry ID 8094
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx45 (Eucgr.A01385 / Egrandis_v1_0.019593m)
Name (synonym) EgrPrx45 (Eucgr.A01385 / Egrandis_v1_0.019593m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx45
start..stop
S start..stop
EglPrx45 669 0 1..322 1..322
EguPrx45 660 0 1..322 1..322
EcamPrx45 659 0 1..318 1..318
EgrPrx43 631 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22311364..22311567 204 N° 2 22312174..22312365 192 N° 3 22312461..22312623 163 N° 4 22312930..22313339 410
join(22311364..22311567,22312174..22312365,22312461..22312623,22312930..22313339 )


exon

Literature and cross-references EgrPrx45 (Eucgr.A01385 / Egrandis_v1_0.019593m)
DNA ref. Phytozome 11:   scaffold_1 (22311364..22313339)
Protein sequence: EgrPrx45 (Eucgr.A01385 / Egrandis_v1_0.019593m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   35116.7 (32744.4)  
PI (pH):   %s   8.55 (8.39) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILAFAARDSVEITGGFGYNVPAGRRDGRVSLAPETINLPLPSFNVNQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQNNDSTLVVPMDPPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMGKIGVLTGSAGEIRANCRVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTATCCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCACCAAGGTCAACTAAAAGCGTCGACTAATTTCCTTTCCTTTTTCCTTTGGTTGTATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTGCAATTTACGCCACTCACATGCCATACCCACGTGCCGGTCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCAATGAAGTATCTTTCGATTAATTTAACG
GAATTGCCATGACCTAATTAATAGATATGATACGTCTACTAATTATATTGCACATTCGAATTGGAATATGATACATACATTTATTAAAAGTTAATTGCTTAACTAGATGTGCCTAAATGC
ATTTAACAAGTTTAGATATTTCCGTTGTGTCTGATGTGTTCATTATTCATCTACCGCAGCTGTCTCATTAATCATGCGCCGTGCTGTAAATCTTGTTTAAATATGCTCCTTCTAAACTCA
ATGACCCTCACAGAAGTACCTTAGCTCTGTTTCGGGAATGGATTTCATTTGTGAGTTTTAAGAAACATCGCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATCGACTCC
ACTCTGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGT
GCTGACATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
GTAATCCCGCAAACCCCTTAACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTT
CTGTTTTCTTTTTGTAGACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTCCCGTCTTTCAACGTCAATC
AACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTATAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAAAA
TAGAACATCAAGATTATGTAGGAAAGAGTAACATTAGAGGAAAAAAATGCTCACAGGGACGAATATAAAGGAAAAAATCATACATGATACTATTCTCTTTTTGAAAGTGGGGTCCTAGAT
TTCTGTAATACTTGGCCCATTATGTGTTTGTAGGCAACTTACATTCTTGAGTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTTACATTAAAAAAAAAAAAACTCGCTTCATGCGTG
TCACAGGAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGA
AGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACAT
CAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACTCAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCGGCTGCAATGGTGAAGATGGGTAAAATCGGTG
TCTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGGGTCATCAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATCGACTCCACTCTG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
ACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTC
CCGTCTTTCAACGTCAATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACT
CAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCGGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGGGTCATC
AATAGCTAA

Retrieve as FASTA