Entry information : EgrPrx09 (Eucgr.A00295 / Egrandis_v1_0.039377m)
Entry ID 8095
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx09 (Eucgr.A00295 / Egrandis_v1_0.039377m)
Name (synonym) EgrPrx09 (Eucgr.A00295 / Egrandis_v1_0.039377m)
Class Class III peroxidase    [Orthogroup: Prx119]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx09
start..stop
S start..stop
EglPrx09 615 0 1..334 1..335
EcamPrx09 610 0 1..334 1..333
EgrPrx08 555 0 1..334 1..337
EglPrx08 536 0 1..334 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3784493..3784738 246 N° 2 3784960..3785145 186 N° 3 3785292..3785451 160 N° 4 3785785..3786197 413
join(3784493..3784738,3784960..3785145,3785292..3785451,3785785..3786197)


exon

Literature and cross-references EgrPrx09 (Eucgr.A00295 / Egrandis_v1_0.039377m)
DNA ref. Phytozome 12:   scaffold_1 (3784493..3786197)
Protein sequence: EgrPrx09 (Eucgr.A00295 / Egrandis_v1_0.039377m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (307)
PWM (Da):   %s   36930.47 (33717.7)  
PI (pH):   %s   8.6 (7.69) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWRLLLLAVLALMSSCAMRRVEAAVGIQPPEKLQWHYYQNSCRDAERYVRNQVEFYWKLDRSLAPKLIRMLYSDCFVTGCDASILLDGPYSEKTAPQNAGLLGFPMAVIDKIKQVLEQRCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRKDGMSSSAALVDLPLGAVPWGSALAYFESRGLDVLDLTTLLGGHSMGKTNCSFIADRLYNFNNTGKPDPSMDSSFLAQMRVQCPPNSKNQVYLDPDSGSSYSFSKSFYSRVLNHRAVLGIDQQIAANNDSSQIAEEYNASFEDFRKIFALSMSRMGNIKVSTGNQGEIRKNCRVVNRK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YSDC'. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGCGGTTGTTGTTGCTGGCGGTGCTCGCATTGATGAGCTCATGCGCCATGCGGCGTGTCGAGGCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCAT
TACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTTGCTCCCAAGCTCATCCGAATGCTCTACTCCGATTGCTTT
GTCACG
GTACGTATCGGCTATTTTTATCCTCTTTTGAGCAATCTTTAAGTCCGCATCGTCTCAACATCGAGTTTCCATCGCCCTTCCAGGTACATGATATCTTTTCACCCAATGGTTTAT
CCTCTCGAACTGGGCTTTCTTACATACCAATTGCCACTCTTTTGTGTACATATATAAAAAACAAAGCCTTGGACTCTCAGATATGTTTGGTTATGTGTATAAAACAGGGGTGTGATGCGT
CAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTAGGGTTTCCTATGGCGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCGGGAG
TCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GTATGGCACCTGGTTTGCACTTCTCTCTCTTTTGGCTTGAAAATGAGTTGTTTTCGCTGCACTGATT
ATTGACATGCTGTTAGCTTGAGCTTGGAGCGTTAAATTTGGAAAATTAGAATCACTGATGCGATACTATGTTGTAATAGGCAGGAGGGCCATCGTACCCCGTTCTGGCGGGGAGGAAGGA
TGGGATGTCGTCCTCCGCAGCGTTGGTGGACCTACCGTTGGGGGCTGTCCCTTGGGGATCAGCTCTCGCGTACTTCGAATCAAGGGGCTTGGATGTGCTGGACCTTACTACTCTACTTG
G
TACAATCCAACCTCATATGCAAAGTATTTATTTGACTTGGACCTCATTAAATTACCTTAGATCTTAAGTAATCCGGGCAATTTGTTTAGTTTAGTGCGGTTGCGAGGAAAAAGAAATCAC
GATGTTACTTTTCGATTTTAAGTTTTCAAAATCTCCGTCTAATTTTCAGGATACAAAGAATTTTATCAGATATAGGATAGTCGAGGATATAATCCAAACCGATCCTCCCAATGATTACCT
CCATGTGCACAAAATGACATGCTTATGTATTATGTCAACTCTCAAAGTCAGAACCATTTCCTAACTTGCCAAAACAATTTAAATTTTGCCAGGGGGGCATTCAATGGGCAAGACCAACTG
CAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACTCATCTTTCTTGGCCCAGATGAGGGTGCAATGCCCACCGAACTCAAAGAATCAAGT
GTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGACCAGCAGATTGCCGCCAACAACGACAGCTC
CCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATGAGCCGGATGGGGAACATCAAGGTCTCAACGGGGAATCAGGGGGAGATTCGCAAGAA
TTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGCGGTTGTTGTTGCTGGCGGTGCTCGCATTGATGAGCTCATGCGCCATGCGGCGTGTCGAGGCGGCAGTGGGGATCCAGCCACCGGAGAAGCTGCAGTGGCAT
TACTACCAGAACTCATGCCGCGACGCGGAGAGGTACGTGAGGAACCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTTGCTCCCAAGCTCATCCGAATGCTCTACTCCGATTGCTTT
GTCACG
GGGTGTGATGCGTCAATTCTGTTGGACGGGCCATATTCAGAGAAAACGGCACCACAAAATGCAGGGCTTCTAGGGTTTCCTATGGCGGTGATAGACAAGATCAAGCAAGTCCTG
GAACAACGTTGTCCGGGAGTCGTCTCTTGTGCTGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GCAGGAGGGCCATCGTACCCCGTTCTGGCGGGGAGGAAGGATGGGATG
TCGTCCTCCGCAGCGTTGGTGGACCTACCGTTGGGGGCTGTCCCTTGGGGATCAGCTCTCGCGTACTTCGAATCAAGGGGCTTGGATGTGCTGGACCTTACTACTCTACTTG
GGGGGCAT
TCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACAGGCTGTACAATTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACTCATCTTTCTTGGCCCAGATGAGGGTGCAATGCCCA
CCGAACTCAAAGAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGACCAGCAGATT
GCCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTCGAGGACTTCCGGAAGATTTTCGCCTTGTCAATGAGCCGGATGGGGAACATCAAGGTCTCAACGGGGAAT
CAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGGAAGTAA

Retrieve as FASTA