Entry information : EgrPrx43 (Eucgr.A00966 / Egrandis_v1_0.019632m)
Entry ID 8099
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx43 (Eucgr.A00966 / Egrandis_v1_0.019632m)
Name (synonym) EgrPrx43 (Eucgr.A00966 / Egrandis_v1_0.019632m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx43
start..stop
S start..stop
EcamPrx43 663 0 1..322 1..322
EguPrx171-2 649 0 1..322 1..322
EglPrx43 637 0 1..322 1..322
EgrPrx45 631 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15361757..15361960 204 N° 2 15360963..15361154 192 N° 3 15360705..15360867 163 N° 4 15359955..15360364 410
complement(join(15359955..15360364,15360705..15360867,15360963..15361154,1536175 7..15361960))


exon

Literature and cross-references EgrPrx43 (Eucgr.A00966 / Egrandis_v1_0.019632m)
DNA ref. Phytozome 11:   scaffold_1 (15361960..15359955)
Protein sequence: EgrPrx43 (Eucgr.A00966 / Egrandis_v1_0.019632m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34843.39 (32471.1)  
PI (pH):   %s   8.09 (7.70) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAMCKGVVSCADILAFAARDSVEKAGGFGYDVPAGRRDGRVSLASETTNLPPPSFNVDQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQQCPQGNDPTLVVPMDPPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARIPSIWKSNFAAAMVKMGKIGVLTGSAGEIRANCRVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTATCCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCATCAAGGTCAACTAAAAGCGTCGACTAATTTCCTTTCCTTTTTCCTTTGGTTGCATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTGCAATTTGCGCTACTCACATGCCATATGCACGTGCGGGCCTCATATGTAGAACATTAATTGACTACTACAAGCTTTTATGTCAATGAAGTATCCTTCGATTAATTTAACG
GAACTATCATGACCTAATTAATAGATATGATATGTCTACTAATTATATTGCACATTCGAATTGGAATATGATACATTTATTAAAAGTTAATTGCTTAACTAGATGTGCCTAAATGCATTT
AACAAGTTTAGAGATTTCAATTGTATCTGATATGTTCATTATTCATCTACCAAAGCTGTCTCATTAATCATGCGCCATGCTGTAAAACTTGTTTAATTATGCTCCTTGTAAACTCAATGA
CCCTCACAGAAGTACCTTAGCTCTGTTTCAGGAATGGATTTCATTTGTGAATTTTAAGAAACATTGCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATTGACTCCACTC
CGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTCAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGCTATGTGCAAAGGAGTTGTTTCCTGTGCTG
ACATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGAAG
GTAATCCCGCAAACCCCTTAACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTTCTGT
TTTCTTTTTGTAGGCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTTCAGAGACTACAAACTTACCTCCCCCGTCTTTCAATGTCGATCAACT
CACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAGAATCCG
ATCAAAAAAAAGAAGAAGAAGTCCAGATAAAGAATAGAACATCAAGATCATGTAGGAAAGAGTAACAATAGAGGAAAAAAATGCTCACAGGGACGAATATAAAGGAAAAAATCATACATG
ATACTATTCTTTTTTTGAAACTGGGGTCCTAGATTTCTGTAATACTTGGCCCATTATGTGTTGTAGGCAACTTACATTATTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTT
ACATTAAAAAAAAAACTTGCTTCATGCGTGTCACAGGAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAA
GCTTGGACCCTACATATGCATCCATGTTGAAGCAACAGTGTCCACAAGGCAATGATCCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGG
GCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAAACACTCCTCACAAACTCTGCAACTGCAAACCAAGTCACTCAAAATGCAAGAATTCCATCCATTTGGAAGAGTAATTTTGCCG
CTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACTGGAAGTGCCGGGGAGATTCGAGCGAATTGCAGGGTCATCAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATTGACTCCACTCCG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTCAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGCTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGAAG
GCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTTCAGAGACTACAAACTTACCTCCC
CCGTCTTTCAATGTCGATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACAGTGTCCACAAGGCAATGATCCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAAACACTCCTCACAAACTCTGCAACTGCAAACCAAGTCACT
CAAAATGCAAGAATTCCATCCATTTGGAAGAGTAATTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACTGGAAGTGCCGGGGAGATTCGAGCGAATTGCAGGGTCATC
AATAGCTAA

Retrieve as FASTA