Entry information : EgrPrx48 (Eucgr.A02147 / Egrandis_v1_0.019606m)
Entry ID 8101
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx48 (Eucgr.A02147 / Egrandis_v1_0.019606m)
Name (synonym) EgrPrx48 (Eucgr.A02147 / Egrandis_v1_0.019606m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx48
start..stop
S start..stop
EglPrx48 654 0 1..322 1..322
EcamPrx48 649 0 1..322 1..322
EguPrx48 615 0 2..322 1..321
PpePrx32 462 9e-166 22..322 21..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32128528..32128731 204 N° 2 32129115..32129879 765  
join(32128528..32128731,32129115..32129879)


exon

Literature and cross-references EgrPrx48 (Eucgr.A02147 / Egrandis_v1_0.019606m)
DNA ref. Phytozome 11:   scaffold_1 (32128528..32129879)
Protein sequence: EgrPrx48 (Eucgr.A02147 / Egrandis_v1_0.019606m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34557.49 (32134.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.66 (6.88) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVCKMKNVVLVLLFVLPLALADLRVGFYNSTCPQAESIVRQVIQKRFGADRSITAALLRMHFHDCFVRGCEASILIDSTAKKPSEKTAGPNFSVRGYDIIDEAKKSLEAACPSTVSCADIITLATRDSVFLAGGPSYNVPTGRRDGLVSNPDEVDLPAPSLSVSEALQAFTAKGFTLTEMVTLLGGHSVGVAHCGLFEDRLSNFQGTGAPDPTMDSSLVAKLKGICGNSTSNDPTAFLDQSTSFIMDNQFYKQIMQKKGVLQIDQELAVDKSSAGIVSRFASDVNSFKTSFASAMVKMGNVQVLTGNAGEIRRNCRAFNQPK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGCAAGATGAAGAACGTAGTACTCGTGCTTCTCTTCGTTCTTCCCCTCGCGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGG
CAAGTCATTCAGAAGAGATTCGGAGCTGATCGATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GTAAGTTACTGGCGTCTTCTGCCGAATGAACATGTA
ACTTTGATATGTTATAGATTAAGGAAAATGACAATGTTAACTAAGTAGCTAGTTTATATATCAATATGTGAAAGCTATGTGACATGCTTTATTGTTACCATTCATCCAGAGTCTAGTAGC
TAACGCAGCAATTGATATATCAATTCCATAATAACTAGCATTAGTCTTAATCATATTGAGTCGCATCAACTCAAACCTGTTAAAGCTCAACAAACATTATGTGAAAATTACTAGACGTTT
AAGAAGAATGATGTTGTGCTCGATTGATGGTGTCAGATAGGTCTGTCACCTCCATTTAACCATAAAAGCATGCCGCTCACATTTTTTTTGCCTCGTTTTCTTTATAGGGCTGTGAGGCAT
CCATCCTCATCGACTCCACCGCCAAGAAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTT
CGACCGTCTCTTGCGCTGACATCATCACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCCACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATG
AAGTGGACTTGCCGGCACCCTCATTGTCGGTATCTGAGGCGCTACAAGCTTTCACGGCTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTC
ACTGTGGCTTGTTCGAAGACCGCCTTTCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACTCGACAAGCAACG
ACCCCACCGCGTTTTTGGACCAAAGCACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTA
GCGCCGGCATTGTTTCTAGGTTCGCGTCAGACGTGAACAGTTTCAAGACGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGA
GGAATTGCCGGGCCTTCAATCAGCCCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGCAAGATGAAGAACGTAGTACTCGTGCTTCTCTTCGTTCTTCCCCTCGCGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGG
CAAGTCATTCAGAAGAGATTCGGAGCTGATCGATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GGCTGTGAGGCATCCATCCTCATCGACTCCACCGCC
AAGAAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTTCGACCGTCTCTTGCGCTGACATC
ATCACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCCACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATGAAGTGGACTTGCCGGCACCCTCA
TTGTCGGTATCTGAGGCGCTACAAGCTTTCACGGCTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTCACTGTGGCTTGTTCGAAGACCGC
CTTTCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACTCGACAAGCAACGACCCCACCGCGTTTTTGGACCAA
AGCACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTAGCGCCGGCATTGTTTCTAGGTTC
GCGTCAGACGTGAACAGTTTCAAGACGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGAGGAATTGCCGGGCCTTCAATCAG
CCCAAGTAA

Retrieve as FASTA