Entry information : EgrAPx[P]02 (Eucgr.A02691 / Egrandis_v1_0.039376m)
Entry ID 8109
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-11 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2012-02-27 (Qiang Li)
Peroxidase information: EgrAPx[P]02 (Eucgr.A02691 / Egrandis_v1_0.039376m)
Name (synonym) EgrAPx[P]02 (Eucgr.A02691 / Egrandis_v1_0.039376m)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx[P]02
start..stop
S start..stop
EcamAPx[P]05 159 1e-53 1..78 1..78
EguAPx[P]05 159 5e-53 1..78 1..78
EguAPx[P]02 157 6e-53 1..78 1..78
EglAPx[P]06 157 3e-52 1..78 1..78
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37527278..37527328 51 N° 2 37527415..37527494 80 N° 3 37527584..37527686 103  
join(37527278..37527328,37527415..37527494,37527584..37527686)


exon

Literature and cross-references EgrAPx[P]02 (Eucgr.A02691 / Egrandis_v1_0.039376m)
DNA ref. Phytozome 11:   scaffold_1 (37527278..37527686)
Protein sequence: EgrAPx[P]02 (Eucgr.A02691 / Egrandis_v1_0.039376m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   78
PWM (Da):   %s   8544.32  
PI (pH):   %s   4.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSDNDIVALSGAHTLGRAHQERSGFDGPWTQEPLKFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYA

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (Just 5' end). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAACGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTCTTATTTT
TTTATTCTTGTGTCTAGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACTGG
ATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGC
ATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAACGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA