Entry information : EgrAPx01 (Eucgr.A01180 / Egrandis_v1_0.024254m)
Entry ID 8110
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrAPx01 (Eucgr.A01180 / Egrandis_v1_0.024254m)
Name (synonym) EgrAPx01 (Eucgr.A01180 / Egrandis_v1_0.024254m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx01
start..stop
S start..stop
EglAPx01 506 0 1..249 1..249
EcamAPx01 503 0 1..245 1..245
EguAPx01 494 2e-180 1..245 1..245
QshAPx01 469 9e-171 1..248 1..248
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18311199..18311317 119 N° 2 18310756..18310930 175 N° 3 18310597..18310662 66 N° 4 18309291..18309339 49
N° 5 18309132..18309214 83 N° 6 18308916..18308995 80 N° 7 18308627..18308729 103 N° 8 18308445..18308503 59
N° 9 18308253..18308268 16  
complement(join(18308253..18308268,18308445..18308503,18308627..18308729,1830891 6..18308995,18309132..18309214,18309291..18309339,18310597..18310662,18310756..1 8310930,18311199..18311317))


exon

Literature and cross-references EgrAPx01 (Eucgr.A01180 / Egrandis_v1_0.024254m)
DNA ref. Phytozome 12:   scaffold_1 (18311317..18308253)
Protein sequence: EgrAPx01 (Eucgr.A01180 / Egrandis_v1_0.024254m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   27371.06  
PI (pH):   %s   6.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKRYPNVSEEYRKAAAKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVQTKTGGPFGTIRHSAELAHEANNGLDIAVRLLEPIKAQFPILSYADFYLAGVVAVEITGGPEIPFHPGRPDKNEPPPEGRLPEATKGSDHLRQVFGHMGLSDKDIVALSGGHTGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGDKEGLIKLPSDKALIEDPIFRPLVEKYADEDAFFADYEEAHLKLSELGFADA

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGCGTTACCCGAACGTCAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGGGGACTCATCGCCGAGAAGCATTGCGCTCCCATCGTCCTTCGACTGGCG
TAAGTAATCTCGCGATCTCCGCTAGTTGCTTGCTTCGGTACCTGTTGATGATCCGGTCCAGAAGTTTCGAGTTCGTAGATGAATGCTTGAACTCACAGATGGACCGATTTCGACCGTTTG
ACGATCGAACCATGTGCATTTTGTCCGGCTTAAGCATCGCTCCGTGGATAGAGAGTTTTGTTTCCGCATGTCGTGGATGCAGCTGGCGACTGTAGATTTGTCGGCGATTGTTTGATTTTT
CTGGTTCGGTGTTCGTTGGCGTCGCAGATGGCACTCCGCCGGTACCTTCGACGTGCAGACGAAGACGGGAGGTCCCTTTGGGACGATCAGGCACTCTGCGGAGCTCGCTCACGAAGCGAA
CAACGGATTGGATATCGCCGTCCGGCTTCTGGAGCCGATCAAGGCACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAG
GTATGACTGCCGAATGCAATTACAACCAAAATTGAATT
TAAGTAATCAAACTACGAAGCACGACGCTGAAATCTTGATATGTTGTATTGGAAGTTGGCTGGGGTTGTTGCTGTTGAAATAACTGGAGGGCCTGAGATTCCTTTCCACCCTGGTAGACC
G
GTAAGTCAATTTTCATCTTTCTTCCAAAACTTGTTTTCTCTATTTGGCGGCTAAAGTAAGGATGAGCTAACTATTCATGCTCAATTTAGAAGCTTTCTTAAGTGGTTTGATGAGGTGTT
TAGCTGCATGACCATGCTGTTGTTCTTTTCTCAAATTAGAATTAAGAGATATGTGCTTGCTGGGATTCTGTTGCTGTTCAGCCTGAATAAACTATTCTAGCTTTTCCCGTAGAAACTTTG
TATTCTTTGAAAGAAGGCCAGCTAGTGTTGGTAGGATTTTGTGAGAATCTAAATAGTGGGAAAAGAGGACACCAAGAACTTCATTGACAAACATAGAAGAAGATTCGCTTAGGTACGTAA
TAGAGCTAATAGAATTTCAGGAAGCAAACAGATACAAGTGAAAAATCTTCTAGTACTGGAAGTTCGATAACTTGTGAATGGTAATCATCCTGAGAAACCAACTCCTGTGAAATGTTTATG
AGCGAGCTAGCATTGCAGCAACAAGAGTCTCAGGAAATATGCAATGTTCCCCCTGGCATTGACCTAATTATAATCGGAAATTCAGTGAATAGCTTCTAGAAGTATAAGTATGATGTCCCT
GTCTTCTTGTCTATTGAACTAATGCTGAAATTGAATATTGAAGTCCTCCATAGTTATTAAAGATGATGTCAAAATGAAAATTGTGTGGGGATCTCCAGATAATTGGATAAAATTGTTTTG
ATATGTGCGGTTTCACTCTCAGAATTGATGATGATTGATGTGTTTCTCGGTTGATGATTGATGTGTATCGTGCCTCCTATTTAGCCTATGAATGTCCCTTCTGGTAGGCTCACTCTGTTC
TCTCTTCTTGATGAAAAATGGGGTTGGAGGTTTCTTGGTTGTTATAGACAAACAGAATAAGAAATGATTCCTCTCGTTGAAACTCTGGCAACTATACTTAGTTTGTCTGACAACCCGACT
TGAGTGATGCAGGTTATGCTTAGTATGTTACTTTGAAATTTCAAATCCTTTAGCTTAATATCGGCCTTCTCATTATACTTTCTTACAACGCAATGGTAAATCCTGTTTGAAATATTGCTT
GTTTAGATAATATACTGTTTTCTTGGTGTATTAGTTAGTAGGCTATATGATACTCGGCATCATAATTCATAGAAACTTGAATCGCTTATTCCCACGGTTCAGATAAAAGCAAAAGTTCTC
TAACATATATTAGATATGAAGGTATCAATAAATCTCTGATAAATTACATTTTGCTCAGGACAAAAATGAACCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAGGTTAGTTTGCTTG
CAGTAAAGTGCGAGAAGATTATTACTGGTGTCTATGCTTTGACAAGTAAACCACTCATTTCAGGTTCCGACCATCTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCG
TTGCCCTATCTGGTGGGCACACTCTG
GTAAGTCGATTAGTCACACAGAGTTAAGTTTCACTCAGAATTACATATTTGCTAAGAATTAAGTCCATGTTGCTGTACAGTTTTGGAGACCTCG
TGAATTCTCTATATTAATGCTCCCTTGCGCTCCTTTCTACAGGGCAGATGCCACAAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTT
AA
GTAAGAATGATCTTGCTCTATTCTTCTATAGTCAACTCAGCAGTTATATATCACCTGCTTAAACTTTGTAACCAGCTTCTTGACTTGCTTAATTAGCGCAGAGAAAAAAACATGGTTT
TGACTTGCTCATGCTGTTGGTCCCTAATGCTGACAATTTTGATATCTGTGGATGTTCCTATGAAACAGGGAACTCCTCAGCGGAGACAAGGAAGGTCTGATCAAGCTACCATCTGACAAG
GCTCTTATTGAGGATCCCATCTTTCGTCCTCTTGTTGAGAAGTACGCTGCG
GTATGTTTGCAACTCAATGTCCTATCGTCATTTCAGAGAATTTTGCGGGGTCATTGATGGTGGAAACAA
TTTTTTTTCTTTTTGGGTGATCGTCTAATCGGGAGGCTGCTTTGGATGTTTCAGGACGAGGATGCATTCTTCGCGGATTATGAAGAAGCTCATCTGAAGCTGTCAGAGCTAGGGTGAGTC
AAGAGACCGCACTCTGTTCGATACAATTCCCCGCAATATTCTTTCGACTTCCTCATTTTCTATTCATCATCTGTTCTCTACTGGTCTCCCTTCGCTCCCCCCATATTTCTGTCTCGGCAC
ATGGAGATGGAACTAACTCTTGTCCCCCTTTCCTTGCTACTTGAATTAGATTTGCGGACGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGCGTTACCCGAACGTCAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGGGGACTCATCGCCGAGAAGCATTGCGCTCCCATCGTCCTTCGACTGGCA
TGGCACTCCGCCGGTACCTTCGACGTGCAGACGAAGACGGGAGGTCCCTTTGGGACGATCAGGCACTCTGCGGAGCTCGCTCACGAAGCGAACAACGGATTGGATATCGCCGTCCGGCTT
CTGGAGCCGATCAAGGCACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAG
TTGGCTGGGGTTGTTGCTGTTGAAATAACTGGAGGGCCTGAGATTCCTTTCCACCCTGGTAGACCG
GACAAAAATGAACCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAGGTTCCGACCATCTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCGTTGCCCTATCTGGT
GGGCACACTCTG
GGCAGATGCCACAAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTTAAGGAACTCCTCAGCGGAGACAAGGAAGGT
CTGATCAAGCTACCATCTGACAAGGCTCTTATTGAGGATCCCATCTTTCGTCCTCTTGTTGAGAAGTACGCTGCG
GACGAGGATGCATTCTTCGCGGATTATGAAGAAGCTCATCTGAAG
CTGTCAGAGCTAGG
ATTTGCGGACGCTTAA

Retrieve as FASTA