Entry information : EgrAPx11 (Eucgr.J02463 / Egrandis_v1_0.023151m)
Entry ID 8119
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrAPx11 (Eucgr.J02463 / Egrandis_v1_0.023151m)
Name (synonym) EgrAPx11 (Eucgr.J02463 / Egrandis_v1_0.023151m)
Class Ascorbate peroxidase    [Orthogroup: APx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx11
start..stop
S start..stop
EguAPx11 530 0 1..267 1..267
EcamAPx11 491 3e-179 16..259 1..244
EglAPx11 474 4e-172 4..265 1..262
CroAPx03 408 1e-145 4..247 6..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30780418..30780527 110 N° 2 30780086..30780210 125 N° 3 30779930..30779979 50 N° 4 30779334..30779399 66
N° 5 30779205..30779253 49 N° 6 30778967..30779055 89 N° 7 30778783..30778862 80 N° 8 30778595..30778697 103
N° 9 30778300..30778431 132  
complement(join(30778300..30778431,30778595..30778697,30778783..30778862,3077896 7..30779055,30779205..30779253,30779334..30779399,30779930..30779979,30780086..3 0780210,30780418..30780527))


exon

Literature and cross-references EgrAPx11 (Eucgr.J02463 / Egrandis_v1_0.023151m)
DNA ref. Phytozome 12:   scaffold_10 (30780527..30778300)
Protein sequence: EgrAPx11 (Eucgr.J02463 / Egrandis_v1_0.023151m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268
PWM (Da):   %s   29438.11  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVVDAEYLKQIEKARRLLRALILSKQCAPIMLRLAWHDAGTYDATTKTGGPNGSIRNEAELRHGSNSGLEIAVDLCEGVKASCPKISYADLYQLAGVVAVEITGGPSVRFVPGRKDSVESPEKGRLPDAVKGENASHLREVFYRMGLSDKDIVALSGGHTLGRAHIDRSGFDGPWTKESLKFDNSYFVELLKGYSPGLLQLPSDRVLVEDTEFLPYVELYAEDEEAFFKDYAQSHKKLSELGFTPDYMGLMLAKLKLAFTSARGH*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGGTCGTGGACGCGGAGTACTTGAAGCAAATCGAGAAGGCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTAAAGATTC
TCGTACCCTTTCTCTTCTTTCTTATTATGCCTTTCTCTTTGGCGAAGTAATGTCTGTTTGAAGGTTGGTGAGTGATGAAACTTGTCGGATTGCGAGTGACCGGGGGCGCATACGCGGTGC
TTTGTAGTGTTTCGCGTAGATTGCCTGTTTAAGACTTCTCAAATAATGTTGGCGCATGATGGTCATGAAATCTGCAGGTGGCACGATGCGGGCACTTATGATGCTACAACAAAGACGGGA
GGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
GTGGGCTTCTGCGGCTTAGCACATATAACTTACCACAT
TCACAAGTTCATTCTACATTTTCTAGGAACGTCTTTCTTCAAATCTTTCTACTTCTATTTTGTTTCAGAAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAGGT
TACTGTCTTTTTCATGAATTTTTGCCTTCTTGGTTAAAAGTTAAATGATCTTCTCAGTTGGTGACATGATAAAGAAATATGTAAACCAGCACATAGGTCACAATGTGCTGCACATGGAAA
GAAATCTTTGAGACTATTGATGAACCTGTACTGCACAAATTCCATAGCCTGATAGTTTCAAACTTTGCTACTCTTATCTGGGTTTGGTGTTAGCTACAGAGAAATCTTGCAGATGTGGTT
TCTAAGATGTTAAGGGTGTTATCTGACATTCCATGTGAGGAGACTTACCCATGCTTACTTTGGATGAAGACGTCGTGGCTAGTTATTTTCTGGCTGTGTTGACTATTTTGCTCGCATTAA
TCATTATATCTCCAGGGACAGTCTCCAGTTGTTTAATAGCTTTGTGTTGAATTGCTTTTTATGGTAACTGATGAGCAGCTAGAGCAGTCTATGTAAAAATTCAAGTTCAAGAGGCAAGAA
TTTTCAGATGTTGTGAACTCGCAAGTTCAGCCATAATTTGTTTTTCAGCTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGTCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGTAAAA
TTGGCAGAAAGAATTCTTGAGGCCTAATGGTTTATGCATCATCACTTATATCGACCAAGTCATTTCTATATTAGGATTCTGTGGAGTCTCCAGAGAAAGGACGTCTTCCAGATGCTGTTA
AAG
GTACGTATCACTAAAACTTTAAGTTTAACAATTCTTAAGTGGTTTGAACTGATGACGCCCATATGAAAATGATACCAGCTTGTATATTAGCAGAGAACCTCAGACTTTCCACAATGC
TCTTAATGTAGTCATTGTTCATCTTAATACAGGCGAAAACGCTTCGCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTT
G
GTAGATATTTCAGAAGCCCTAAACTGCTTCATACGAGTCCTTCCCTGCAGTATCAGCAGTTTGTGCATATTCCGATTTCTTCCTTTTCTTCTCTGAATTTTCAGGGAAGGGCACATATA
GATAGATCAGGCTTTGATGGACCCTGGACCAAGGAATCCCTTAAGTTCGATAATTCTTATTTTGT
GTAAGAGAAGATCACACTTCGATGCAATTCTCTCTATTCAAACTCTACTTCCATC
AGATGAGCTTTCTGCACAATGCTTGCGCAGGGAACTTCTGAAAGGATACTCACCAGGACTTCTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCTTCCCTATGTCGA
GCTATATGCTGAG
GTACACTATCGATCTAAAGGGGGGCTTTGGAACATCTTGTCTTTTAAGTCGTGCTGAAAGAGGCAGTACATGTCCCCAATGGAAGTTCATCATTCTTTGTGCTAGTT
TCTTCTTTGTGAGAGAGTTTTCTTTATGTTCTTTTTGGTTTCCGAGCGACATGCAGGATGAGGAAGCCTTCTTTAAAGACTATGCACAGTCACACAAGAAGCTGTCCGAGCTAGGCTTTA
CTCCGGATTACATGGGCTTAATGCTAGCAAAGCTCAAATTGGCATTTACTTCAGCCCGGGGTCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGGTCGTGGACGCGGAGTACTTGAAGCAAATCGAGAAGGCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTGGCACGAT
GCGGGCACTTATGATGCTACAACAAAGACGGGAGGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
AAGGA
GTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAG
CTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGTCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGATTCTGTG
GAGTCTCCAGAGAAAGGACGTCTTCCAGATGCTGTTAAAG
GCGAAAACGCTTCGCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGC
CATACTTTG
GGAAGGGCACATATAGATAGATCAGGCTTTGATGGACCCTGGACCAAGGAATCCCTTAAGTTCGATAATTCTTATTTTGTGGAACTTCTGAAAGGATACTCACCAGGACTT
CTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCTTCCCTATGTCGAGCTATATGCTGAG
GATGAGGAAGCCTTCTTTAAAGACTATGCACAGTCACACAAGAAGCTG
TCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCAAAGCTCAAATTGGCATTTACTTCAGCCCGGGGTCACTGA

Retrieve as FASTA