Entry information : EgrPrx156 (Eucgr.J02352 / Egrandis_v1_0.019338m)
Entry ID 8120
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx156 (Eucgr.J02352 / Egrandis_v1_0.019338m)
Name (synonym) EgrPrx156 (Eucgr.J02352 / Egrandis_v1_0.019338m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx156
start..stop
S start..stop
EglPrx156 667 0 1..326 1..326
EcamPrx156 663 0 1..326 1..326
EguPrx156 635 0 1..326 1..326
CclPrx43 518 0 8..325 7..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29469768..29469980 213 N° 2 29471107..29471298 192 N° 3 29471415..29471990 576  
join(29469768..29469980,29471107..29471298,29471415..29471990)


exon

Literature and cross-references EgrPrx156 (Eucgr.J02352 / Egrandis_v1_0.019338m)
DNA ref. Phytozome 11:   scaffold_10 (29469768..29471990)
Protein sequence: EgrPrx156 (Eucgr.J02352 / Egrandis_v1_0.019338m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (302)
PWM (Da):   %s   34825.26 (32256.8)  
PI (pH):   %s   4.82 (4.59) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARKLGLWLAVVFAVAATAEVGRAQLTEGFYGQTCPNVESIVKQAVTTKFGQTFITIPGTLRLFFHDCFIEGCDASILISSPNGDAEKDAPDNQSLAGDGFDTVIKAKQAVEASCQGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLISKASQVAGKLPEPNFDLDQLNAIFSQHGLTQSDMIALSGAHTLGFSHCDRFANRLYSFSSSSPVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPQTFDNMYYTNLVQGKGLFTSDETLFTDSASKPTVLNFANSPGSFNQAFATAMRKLGRVGIKTGSQGEIRRDCTAFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGCGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCATCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GTGAATCCCTTTTCCTCCATGCATGCA
TTTCCGATCATGCTGCCTTCTCCTCCTTTTTCAGTTTCATCTGATTAATCACACATACATAACCCTGGCAAGTAATAGCCTTTCGATCGCAATTCCAAAAGCCCTGAATCAATTGCTAAT
TCATTCGATTAACTCTCATTTCCACAATCTTTCGGATATTCGTCCAGTCTTACACCGTAATATTTTCTTTTTCGGTATATCTTCATGAATATTTTTCTTTAAGTAAAAAGGGAATTAGAA
TGTACATGGATTATCGTTACTTCTTCCACAATGTTACCCAAGTTTTTTAGACGGTCAAAATTGCCGCTCGTTCTTTGCTTGAGCTGAGCCGGAGTTTGAACATTTGGCGAGGTTCTATCC
TAACATCGTACAAATTATATCAATTATATAGAGGAATCATAAGGAACAAGAAGTTGACTTTGGAACACATGTTTTACGTTTTCAATCATTTCATGGACAAAATGAGACGTTTTCATCTAC
CCCAATATTTTCCCGACCAAAAAAAAAAAAAAAAAGCTGCCCCAATATTTTAACGAGCTTTCTCACAGAGCCCCAACCACGCCTTTTGAATTAATTAATCGCAATTTGTCGAAATTAATT
GTGACAACAATTTAATTAAGGGAATCAAAAGCATTCCAAGTGAAATTGCCAAACAGAGATATTTTTCCAGGGGGCAGGTAAGTGCATAACTAGTTGCACAAGACAATACAAGAACAATTG
AAAGAAAATGAAATTGAATCTCATGGATCAACAATCGCATTCACATTCACTCGTTATTAAGTCTTGGCGTATGAAAAACTCTCATATATTCAAGTTAGCACTGACCCTTAAACGGGCATC
GTCGTGTTGATTTTCCTTATCTTGGACTTAATTGTGTGATGATTCCTCGGGCTTGGTCACGCATTAAACTAGGAGATATGTAAAAAGATTAGAAACCTTAAATCTATTCACCGAACTTTC
TTTTCAGGGTCCGATCTTGTTCATAAAATATGTCCTGGGAGGTATGAATTAGTTCAGGATTACTTTAGATAAGAAACGCCTGACATGAATTTCCATTCAATCACGGTTTCGGCTAGTTAA
TTTCGATGTTGTTTTTAAGGGATGCGATGCTTCGATTTTGATCTCGTCGCCTAACGGGGATGCTGAGAAAGACGCTCCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTAT
CAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCATGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GTAAGCAAGAACCTCGGTGGACAGTTCAC
CCTCGCAGCTCAATGTCGAGTCAAATGACTGTCATGCTCCAAGTCTTAACGTTTTCTCACTCGTTCAATGTGCATGAAAAATCTCAGGCCGGAGGTCCATCGTTCAACGTCGAGCTCGGC
CGTCGCGACGGTCTCATCTCCAAAGCATCTCAAGTAGCCGGGAAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACACAATCTGACATG
ATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGCGACCGATTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCTGTG
CAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATAGCAATCAACATGGACCCCGTGACTCCACAGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTG
TTCACTTCGGACGAGACGCTCTTCACCGATTCAGCGTCCAAGCCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTTGCCACCGCGATGAGGAAGCTCGGGAGG
GTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGATTGTACAGCTTTCAATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGCGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCATCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GGATGCGATGCTTCGATTTTGATCTCG
TCGCCTAACGGGGATGCTGAGAAAGACGCTCCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTATCAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCA
TGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GCCGGAGGTCCATCGTTCAACGTCGAGCTCGGCCGTCGCGACGGTCTCATCTCCAAAGCATCTCAAGTAGCCGGG
AAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACACAATCTGACATGATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGC
GACCGATTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCTGTGCAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATA
GCAATCAACATGGACCCCGTGACTCCACAGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTGTTCACTTCGGACGAGACGCTCTTCACCGATTCAGCGTCCAAG
CCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTTGCCACCGCGATGAGGAAGCTCGGGAGGGTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGAT
TGTACAGCTTTCAATTCATGA

Retrieve as FASTA