Entry information : EgrPrx131 (Eucgr.H04063 / Egrandis_v1_0.019415m)
Entry ID 8129
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-11-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx131 (Eucgr.H04063 / Egrandis_v1_0.019415m)
Name (synonym) EgrPrx131 (Eucgr.H04063 / Egrandis_v1_0.019415m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx131
start..stop
S start..stop
EguPrx131 660 0 1..327 1..327
EglPrx131 660 0 1..327 1..327
EcamPrx131 655 0 1..327 13..339
VvPrx19 490 3e-176 18..327 25..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58503710..58503931 222 N° 2 58504034..58504225 192 N° 3 58504341..58504506 166 N° 4 58504778..58505181 404
join(58503710..58503931,58504034..58504225,58504341..58504506,58504778..58505181 )


exon

Literature and cross-references EgrPrx131 (Eucgr.H04063 / Egrandis_v1_0.019415m)
DNA ref. Phytozome 12:   scaffold_8 (58503710..58505181)
Protein sequence: EgrPrx131 (Eucgr.H04063 / Egrandis_v1_0.019415m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   35089.18  
PI (pH):   %s   4.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFELSAVALSKSPTTSREECADDHNASPLSTTFYEDTCPEAEAIIFAWVDRAVSEDPRMAASLLRLHFHDCFVNGCDASVLLDDIEGFVGEKTAGPNLNSLRGFEVVDAIKSELETVCPSTVSCADILASAARDSVLVSGGPGWDVLMGRRDSLGASRDAANNNIPAPNSTVEILVAKFQSAGLTLNDMVALSGAHTLGKARCPTFRSRLAGSAHSTGPKVNLEFLQSLQQLCSGPDSNSTLAELDLVTPATFDNQYYVNLVSGEGLLQSDQVLFAGDDRTRQIVESYAEDPMTFFEDFKLSMVRMGSLGPLTGKEGEIRRNCRIAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGAGCTGAGTGCCGTTGCCCTTTCGAAATCACCCACCACCTCGCGCGAAGAATGTGCAGACGATCACAATGCAAGCCCCTTGAGCACCACTTTCTATGAGGACACGTGCCCCGAA
GCGGAGGCGATCATCTTTGCATGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTTCATGACTGTTTCGTCAAT
GCAAGTTTTGAAATCGAT
ATTGTCGTGGCATTTTCTCTTTCCAAATGTTCAAGTGAATAAGTTCAAGGTTCTCTTTTTTCTGTCAAATTATTTTTGGTGCAGGGATGCGATGCTTCTGTCCTTTTGGATGACATTGAA
GGTTTCGTGGGAGAGAAGACGGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGACGCTATAAAATCTGAGCTTGAAACTGTTTGTCCTAGTACAGTTTCATGTGCCGAT
ATCCTTGCAAGCGCTGCCAGAGACTCTGTTTTAGTG
GTACGTTCTCAATCCGAATGGCACCTTAGGTACTCCGTAACTTGTAAAATTTCTGAACTTGGAAGAGGGTTGTTAAGATATTAC
AGTCTAAGCTGATTCTTAGAATGAATCGCAGTCGGGCGGGCCTGGATGGGATGTTCTGATGGGTCGGAGAGACAGCTTAGGCGCGAGCAGAGACGCAGCGAACAACAACATTCCGGCGCC
GAATTCTACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGACATGGTCGCCCTATCTG
GTATCTTCTCCTGTTTATTATCCGATCCCCTAGTTTTGCACAT
CATGCCCTTCAAGCGCTTGAAAATTCACCTAGTGCAACGCCATTTTTAGGGGAAATAATTTGACGCGACGATGTAGAAACGTAGCGTCAACATGTTTTTTCCAGGTTATTATTAGGTGAA
CGTCGCAGCAACCTGGTATTTAATGTTTAGGAACTTGGGTGATGAGACCAAGTCTGCACATGCTAACAATACTGGAATTAGAAAGGATCGTTTGCTACTTTCACGCAGGTGCGCACACTC
TGGGAAAGGCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTCCTTCAGTCACTGCAGCAGCTTTGCTCGGGTCCCGATA
GCAATTCGACTCTAGCAGAGCTCGACCTGGTGACGCCGGCGACTTTTGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAGGGGCTGCTTCAGTCCGACCAGGTTCTCTTTGCCGGAG
ACGACAGGACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCATGACGTTCTTCGAGGATTTCAAACTCTCGATGGTGAGAATGGGGAGCCTGGGGCCGCTCACGGGGAAAGAGGGCG
AAATCAGAAGAAATTGTAGAATCGCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGAGCTGAGTGCCGTTGCCCTTTCGAAATCACCCACCACCTCGCGCGAAGAATGTGCAGACGATCACAATGCAAGCCCCTTGAGCACCACTTTCTATGAGGACACGTGCCCCGAA
GCGGAGGCGATCATCTTTGCATGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTTCATGACTGTTTCGTCAAT
GGATGCGATGCTTCTGTC
CTTTTGGATGACATTGAAGGTTTCGTGGGAGAGAAGACGGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGACGCTATAAAATCTGAGCTTGAAACTGTTTGTCCTAGT
ACAGTTTCATGTGCCGATATCCTTGCAAGCGCTGCCAGAGACTCTGTTTTAGTG
TCGGGCGGGCCTGGATGGGATGTTCTGATGGGTCGGAGAGACAGCTTAGGCGCGAGCAGAGACGCA
GCGAACAACAACATTCCGGCGCCGAATTCTACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGACATGGTCGCCCTATCTG
GTGCGCACACTCTGGGAAAG
GCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTCCTTCAGTCACTGCAGCAGCTTTGCTCGGGTCCCGATAGCAATTCG
ACTCTAGCAGAGCTCGACCTGGTGACGCCGGCGACTTTTGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAGGGGCTGCTTCAGTCCGACCAGGTTCTCTTTGCCGGAGACGACAGG
ACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCATGACGTTCTTCGAGGATTTCAAACTCTCGATGGTGAGAATGGGGAGCCTGGGGCCGCTCACGGGGAAAGAGGGCGAAATCAGA
AGAAATTGTAGAATCGCCAACTGA

Retrieve as FASTA