Entry information : SbPrx97 (Sobic.006G277500.1 [2.1] / SB06G033840 [1.4])
Entry ID 813
Creation 2005-12-29 (Christophe Dunand)
Last sequence changes 2005-12-29 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx97 (Sobic.006G277500.1 [2.1] / SB06G033840 [1.4])
Name (synonym) SbPrx97 (Sobic.006G277500.1 [2.1] / SB06G033840 [1.4])
Class Class III peroxidase    [Orthogroup: Prx061]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Leaves
Roots
Seedlings
Inducers Abscissic acid treatment
Acid treatment
Alkaline treatment
Ethylene treatment
Heat shock stress
Light growth
Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx97
start..stop
S start..stop
ZmPrx24 577 0 34..361 26..356
SiPrx88 551 0 8..361 3..349
ZmPrx58 530 0 30..361 22..350
SofPrx14 528 0 5..361 4..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61777902..61778174 273 N° 2 61777527..61777712 186 N° 3 61776788..61777417 630  
complement(join(61776788..61777417,61777527..61777712,61777902..61778174))


exon

Literature and cross-references SbPrx97 (Sobic.006G277500.1 [2.1] / SB06G033840 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_6 (61778174..61776788)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.15561.1
Protein sequence: SbPrx97 (Sobic.006G277500.1 [2.1] / SB06G033840 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (329)
PWM (Da):   %s   38336.08 (35143.5) Transmb domain:   %s   i13-35o
PI (pH):   %s   5.37 (4.89) Peptide Signal:   %s   cut: 34 range:34-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSSRCSCSRSVAAVQLLVAISAVCGAALSSATVTVNEPDIANGLSWRFYDASCPYVEDIVSWHVTEALRRDIGIAAGLIRIFFHDCFPQGCDASVLLSGPKSEQIEIPNQTLRPAALKLIDDIRADVHATCGPTVSCADITTLATRDAVVASGGPFFDVPLGRRDGLAPASSDLVGTLPAPFFDVPTLISAFENRGLNKADLVALSGAHTVGRGHCSSFSDRLPPNADDDTMDPAFRRKLAAKCASDPSGNVVTQVLDVRTPDAFDNKYYFDLIAKQGLFKSDQGLINHPDTMRTATRFALNQAAFFEQFARSFVKMSQMDVLTGTAGEIRLNCSVPNIVVSSSAHTAAGDGDEGRAADE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, introns 1 and 2) and 18 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGGTCGTCCCGCTGCAGCTGCAGCAGATCAGTGGCCGCCGTGCAGCTGCTGGTGGCCATCTCAGCGGTCTGCGGCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAACGAACCC
GATATCGCAAACGGCCTCTCCTGGAGGTTCTACGACGCGTCCTGCCCGTACGTGGAGGACATCGTGAGCTGGCACGTCACCGAGGCACTCCGCCGCGACATCGGCATCGCCGCCGGGCTC
ATCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GTAACGATCGATCCGCCCTGGAGCTACGTTAAAACGTTGTTGATGCTGACGATGACCAATTAATTAAGACCGACCAACACACACACA
CACACACACACAGTTCACAAGCATATAACAATATATAATCCATGAACGAAACTGTGAATAATAAAACGTAGTACCATCGATCACCCATCATGCATCGATCAGGGCTGCGACGCGTCCGTG
CTCCTGTCGGGTCCCAAGAGCGAGCAGATTGAGATACCCAACCAGACGCTGCGTCCCGCGGCGCTGAAACTCATCGACGACATCCGCGCCGACGTCCACGCCACCTGTGGGCCAACCGTG
TCCTGCGCCGACATCACCACGCTAGCTACCCGGGACGCCGTCGTCGCG
GTAAGTCCATCGCCGGCCGGCCGTTCATCACCCTAGCTACTATATATCTGAGAGTATATATGTACGTTGGAT
ACCTTGCTGTATATCGACGCCTACTCCATCCATCCAGTCCGGCGGCCCCTTCTTCGACGTTCCTCTGGGGCGTCGCGACGGTCTGGCGCCGGCGTCGAGCGACCTGGTGGGCACCCTGCC
GGCGCCCTTCTTCGACGTTCCGACGCTGATCTCGGCGTTCGAGAACCGCGGCCTGAACAAGGCGGACCTGGTGGCTCTCTCCGGCGCGCACACCGTGGGCCGCGGCCACTGCTCCTCCTT
CAGCGACCGTCTGCCGCCGAACGCGGACGACGACACCATGGACCCGGCGTTCCGGCGGAAGCTGGCGGCCAAGTGCGCCAGCGACCCCAGCGGGAACGTGGTCACCCAGGTGCTGGACGT
GCGCACGCCCGACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGCTGTTCAAGTCGGACCAGGGCCTCATCAACCACCCGGACACCATGCGCACCGCCACACGCTT
CGCGCTCAACCAGGCCGCCTTCTTCGAACAGTTCGCCAGGTCCTTCGTCAAGATGAGCCAGATGGACGTGCTCACCGGCACCGCCGGAGAGATCCGCCTCAACTGCTCCGTGCCCAATAT
CGTCGTCTCATCATCAGCCCACACCGCCGCCGGCGACGGCGACGAGGGGCGAGCGGCCGACGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAGGTCGTCCCGCTGCAGCTGCAGCAGATCAGTGGCCGCCGTGCAGCTGCTGGTGGCCATCTCAGCGGTCTGCGGCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAACGAACCC
GATATCGCAAACGGCCTCTCCTGGAGGTTCTACGACGCGTCCTGCCCGTACGTGGAGGACATCGTGAGCTGGCACGTCACCGAGGCACTCCGCCGCGACATCGGCATCGCCGCCGGGCTC
ATCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GGCTGCGACGCGTCCGTGCTCCTGTCGGGTCCCAAGAGCGAGCAGATTGAGATACCCAACCAGACGCTGCGTCCCGCGGCGCTGAAA
CTCATCGACGACATCCGCGCCGACGTCCACGCCACCTGTGGGCCAACCGTGTCCTGCGCCGACATCACCACGCTAGCTACCCGGGACGCCGTCGTCGCG
TCCGGCGGCCCCTTCTTCGAC
GTTCCTCTGGGGCGTCGCGACGGTCTGGCGCCGGCGTCGAGCGACCTGGTGGGCACCCTGCCGGCGCCCTTCTTCGACGTTCCGACGCTGATCTCGGCGTTCGAGAACCGCGGCCTGAAC
AAGGCGGACCTGGTGGCTCTCTCCGGCGCGCACACCGTGGGCCGCGGCCACTGCTCCTCCTTCAGCGACCGTCTGCCGCCGAACGCGGACGACGACACCATGGACCCGGCGTTCCGGCGG
AAGCTGGCGGCCAAGTGCGCCAGCGACCCCAGCGGGAACGTGGTCACCCAGGTGCTGGACGTGCGCACGCCCGACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGG
CTGTTCAAGTCGGACCAGGGCCTCATCAACCACCCGGACACCATGCGCACCGCCACACGCTTCGCGCTCAACCAGGCCGCCTTCTTCGAACAGTTCGCCAGGTCCTTCGTCAAGATGAGC
CAGATGGACGTGCTCACCGGCACCGCCGGAGAGATCCGCCTCAACTGCTCCGTGCCCAATATCGTCGTCTCATCATCAGCCCACACCGCCGCCGGCGACGGCGACGAGGGGCGAGCGGCC
GACGAGTGA

Retrieve as FASTA