Entry information : EgrPrx125 (Eucgr.H03666 / Egrandis_v1_0.040155m)
Entry ID 8132
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx125 (Eucgr.H03666 / Egrandis_v1_0.040155m)
Name (synonym) EgrPrx125 (Eucgr.H03666 / Egrandis_v1_0.040155m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx125
start..stop
S start..stop
EguPrx125 659 0 1..326 1..326
EglPrx125 627 0 1..324 1..324
EgrPrx126 565 0 1..326 1..328
EglPrx126 562 0 1..326 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53745621..53745833 213 N° 2 53745060..53745251 192 N° 3 53744790..53744955 166 N° 4 53744206..53744615 410
complement(join(53744206..53744615,53744790..53744955,53745060..53745251,5374562 1..53745833))


exon

Literature and cross-references EgrPrx125 (Eucgr.H03666 / Egrandis_v1_0.040155m)
DNA ref. Phytozome 11:   scaffold_8 (53745833..53744206)
Protein sequence: EgrPrx125 (Eucgr.H03666 / Egrandis_v1_0.040155m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35108.88 (32689.5)  
PI (pH):   %s   8.48 (8.21) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTARKVHLVLSLSLLLVVACNADGKLRENFYKKSCPQAEKLVRDITWSKAQSDPTLGAKLLRMHYHDCFVQGCDGSILLDPVGTTQSEKNAVPNLALAGFDVIDDIKTQVEQACPNIVSCADVLSLAARDAVSFPFNKSMWNVLTGRRDGKVSLASNVAGKLPSPFANFSTLAQSFSETGLNVNDLVVLSGAHTIGVAHCGIISNRLYNFTGKGDADPSLNAAYAASLRTQCPNPANPAKTVDMDPQSSLSFDSHYFDILTENKGLFQSDAALLTNRGAAKVVQRLRSPAKFFAEFGKSMKKMGDIEVLTGTAGEIRKQCRVVNQS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGCTAGGAAAGTTCATTTGGTTTTATCACTAAGTCTTCTCTTGGTTGTAGCGTGCAATGCAGATGGTAAATTGAGGGAGAACTTCTACAAGAAGAGTTGCCCTCAAGCTGAGAAG
CTTGTGAGGGACATCACTTGGAGCAAGGCCCAATCTGACCCTACTCTGGGTGCTAAGCTTCTCAGGATGCACTATCACGATTGCTTTGTTCAG
GTAGCAAATTCCTATATATCCCCACCG
TAGCTTTTCCAATCAAAACATGCCGAGAGTAACCATTTTCTATGAGAAAAGTTGCCGGCTTTCTTTTTTTTACGGTGTGTCACTCGAGATTCCTGTCAACCTAATTAAAAGTTTAAGCCA
TCATTATGCCAATGATCATCTTCGCTTGTTGAGACAGAAGATGGGGAATGTAGGGAACATATTGTTCAACTTGTATTTCTCTAATTACTTTAAACTTTTAGACTTATAGGATATGAACAT
ATCTCAACCGTTCTAGATAAATCTTGTTTTACATCATAAGCATTCGGACTTAGCGAGCTCAACTCTCCATTTGATGAAATTGTGGAAATAATTATTTCATAGGGATGCGATGGATCTATA
CTGCTGGACCCTGTGGGGACAACCCAATCTGAGAAGAACGCAGTACCAAATCTCGCCCTGGCTGGTTTTGATGTTATCGATGACATCAAGACACAAGTTGAGCAAGCTTGCCCTAACATC
GTCTCTTGCGCTGACGTTCTTTCTCTAGCTGCTCGCGATGCTGTTTCTTTCCCT
GTAAGATAAACTTGCCTGATCGATTGTCTAAAACCATAATTTTCATCATAAAAAATGGTCGAAATA
TAAGGTTTGTCATTTGAACACGATGGCGTGAATTGCAGTTTAACAAGTCGATGTGGAATGTGTTGACGGGAAGAAGAGACGGCAAGGTTTCATTAGCGTCCAATGTCGCTGGGAAGCTTC
CATCTCCTTTCGCAAACTTTAGTACTCTCGCACAAAGTTTCTCTGAGACAGGCCTTAATGTGAACGATCTTGTCGTTCTCTCTG
GTAAGCCAACATGATCATGTCTTTTTTCGGATGTTT
GAATTGATATTTCGTGACTTACATTTGGATCATCAAATTGGCATTGAAGCTAATTAAAGTACATAACTGACATACTGCATCGAGTTAGACATTGCACAATGTGTAATGAAGTCATATATA
TCTTTGCTCCTTCATCAGGTGCGCATACCATTGGAGTTGCTCATTGCGGCATAATTTCCAATAGGCTCTACAACTTCACCGGGAAAGGAGATGCCGATCCCTCTCTGAACGCTGCCTACG
CTGCATCCCTCCGGACCCAGTGCCCTAACCCGGCCAACCCGGCTAAGACGGTGGACATGGATCCACAAAGCTCCCTCTCCTTCGATAGCCATTACTTCGATATTCTCACGGAAAACAAGG
GATTGTTCCAATCTGACGCTGCGCTCTTGACAAACCGAGGCGCAGCCAAGGTGGTCCAGCGCCTTCGGTCGCCAGCCAAGTTCTTTGCTGAGTTTGGCAAATCAATGAAGAAAATGGGGG
ACATCGAGGTACTGACGGGAACTGCCGGAGAGATTAGAAAACAATGTCGTGTTGTGAATCAATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGCTAGGAAAGTTCATTTGGTTTTATCACTAAGTCTTCTCTTGGTTGTAGCGTGCAATGCAGATGGTAAATTGAGGGAGAACTTCTACAAGAAGAGTTGCCCTCAAGCTGAGAAG
CTTGTGAGGGACATCACTTGGAGCAAGGCCCAATCTGACCCTACTCTGGGTGCTAAGCTTCTCAGGATGCACTATCACGATTGCTTTGTTCAG
GGATGCGATGGATCTATACTGCTGGAC
CCTGTGGGGACAACCCAATCTGAGAAGAACGCAGTACCAAATCTCGCCCTGGCTGGTTTTGATGTTATCGATGACATCAAGACACAAGTTGAGCAAGCTTGCCCTAACATCGTCTCTTGC
GCTGACGTTCTTTCTCTAGCTGCTCGCGATGCTGTTTCTTTCCCT
TTTAACAAGTCGATGTGGAATGTGTTGACGGGAAGAAGAGACGGCAAGGTTTCATTAGCGTCCAATGTCGCTGGG
AAGCTTCCATCTCCTTTCGCAAACTTTAGTACTCTCGCACAAAGTTTCTCTGAGACAGGCCTTAATGTGAACGATCTTGTCGTTCTCTCTG
GTGCGCATACCATTGGAGTTGCTCATTGC
GGCATAATTTCCAATAGGCTCTACAACTTCACCGGGAAAGGAGATGCCGATCCCTCTCTGAACGCTGCCTACGCTGCATCCCTCCGGACCCAGTGCCCTAACCCGGCCAACCCGGCTAAG
ACGGTGGACATGGATCCACAAAGCTCCCTCTCCTTCGATAGCCATTACTTCGATATTCTCACGGAAAACAAGGGATTGTTCCAATCTGACGCTGCGCTCTTGACAAACCGAGGCGCAGCC
AAGGTGGTCCAGCGCCTTCGGTCGCCAGCCAAGTTCTTTGCTGAGTTTGGCAAATCAATGAAGAAAATGGGGGACATCGAGGTACTGACGGGAACTGCCGGAGAGATTAGAAAACAATGT
CGTGTTGTGAATCAATCGTAA

Retrieve as FASTA