Entry information : EgrPrx126 (Eucgr.H03667 / Egrandis_v1_0.047140m)
Entry ID 8133
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx126 (Eucgr.H03667 / Egrandis_v1_0.047140m)
Name (synonym) EgrPrx126 (Eucgr.H03667 / Egrandis_v1_0.047140m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx126
start..stop
S start..stop
EglPrx126 675 0 1..328 1..328
EguPrx126 671 0 1..328 1..328
EcamPrx126 580 0 47..328 1..282
EgrPrx125 565 0 1..328 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53795159..53795377 219 N° 2 53794572..53794763 192 N° 3 53794303..53794468 166 N° 4 53793719..53794128 410
complement(join(53793719..53794128,53794303..53794468,53794572..53794763,5379515 9..53795377))


exon

Literature and cross-references EgrPrx126 (Eucgr.H03667 / Egrandis_v1_0.047140m)
DNA ref. Phytozome 11:   scaffold_8 (53795377..53793719)
Protein sequence: EgrPrx126 (Eucgr.H03667 / Egrandis_v1_0.047140m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   35312.89 (32993.6)  
PI (pH):   %s   7.42 (7.06) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAGKGHLVLSLTLLLVLACNADDDGGLRKNFYKKSCPQAEKLVRDITWSKAQADPTLGAKLLRVHYHDCFVRGCDGSVLLDPVGTNQSEKNAVPNLTLAGFDVIDDIKKQVEQACPNTVSCADVLSLAARDAVSFPFKKPIWDVLMGRRDGNISLASNIPGNLPSPFADFSTLAQIFSKKGLNVNDLVVLSGAHTIGVAHCGTFSRRLYNFTGKGDADPSLNATYAASLRTQCPNPANPATTVEMDPQSSLSFDSHYFDILIENEGLFQSDAALLTNQGAAKVVQHLRSPDAFFSEFGKSMKKMGAIEVLTGTAGEIRKQCRVVNQS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTGAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GTAACAAATTCCTATATATCC
CCAAAGTAGATTCCCTGATCGAAACATGTGAAGAGTAACTACTATCTACAATAAAAGTTGCCGACCTTTCTTCTTTATAGTGTGTGACTTGAGATTCCTGTCAACCTATCTAAAAGTTTA
AGTCATTGTTATGCCAATAATCATCGTTGCTTGTTGAGACAGTAGGCAGGGAATATAGGGAACATATCTCAACCGTTCTGCATGGTTCATGCTTCACATCATATACGTTTGAACTTAGCG
AGCTCAACTCTCCATGTGATGAGTTAGGGCTTAAGACGTATGACTTTGCATTTGACATTATTAGAGAAATAGTTGCATCTAATGTCTCTCAATCACACCAAGGTTGACGAAATTCTGGAA
TAATTCATTTTTAGGGATGTGATGGATCCGTACTGCTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCA
AGAAACAAGTTGAGCAAGCTTGCCCCAACACTGTCTCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
GTAAGAAAACCTGCCTAATTGATTGTCTAAAATC
ATTAATTTCTTCGCTGAAAATGGTCAAAATATAAGGTTTGTCATTTGAATATGATGGCGTAAATTGCAGTTTAAGAAGCCGATTTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATT
TCGTTAGCATCCAACATCCCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTACTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTAAG
CCGACGTGATCATGTCCTTTTTCGGATGGTTGAATTAAGATTTCCACACTTACATTTGGATCTTCAAATTAACATCGAAGCTAATTAAAGTACAAAACTGACATACTGCATTGAGTTAGA
CATTTCACAATGTACAATGAAATCATCTATATCTTTGCTCCTTCACCAGGTGCACATACCATTGGAGTTGCTCATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGA
GACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCGGCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGC
CATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGTGCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCC
GAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAACAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTGAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GGATGTGATGGATCCGTACTG
CTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCAAGAAACAAGTTGAGCAAGCTTGCCCCAACACTGTC
TCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
TTTAAGAAGCCGATTTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATTTCGTTAGCATCCAACATC
CCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTACTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTGCACATACCATTGGAGTTGCT
CATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGAGACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCG
GCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGCCATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGT
GCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCCGAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAA
CAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA