Entry information : EgrPrx[P]128 (Eucgr.H03669 / Egrandis_v1_0.050016m)
Entry ID 8137
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-03-11 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-03-09 (Qiang Li)
Peroxidase information: EgrPrx[P]128 (Eucgr.H03669 / Egrandis_v1_0.050016m)
Name (synonym) EgrPrx[P]128 (Eucgr.H03669 / Egrandis_v1_0.050016m)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]128
start..stop
S start..stop
EguPrx[P]128 572 0 1..282 1..282
EglPrx[P]128 572 0 1..282 1..282
EcamPrx[P]128 495 9e-180 1..266 20..298
EgrPrx[P]127 369 1e-129 1..282 29..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53810094..53810226 133 N° 2 53809452..53809606 155 N° 3 53809165..53809330 166 N° 4 53808637..53809028 392
complement(join(53808637..53809028,53809165..53809330,53809452..53809606,5381009 4..53810226))


exon

Literature and cross-references EgrPrx[P]128 (Eucgr.H03669 / Egrandis_v1_0.050016m)
DNA ref. Phytozome 12:   scaffold_8 (53810226..53808637)
Protein sequence: EgrPrx[P]128 (Eucgr.H03669 / Egrandis_v1_0.050016m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   279
PWM (Da):   %s   30382.44  
PI (pH):   %s   8.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFYRESCPRAEAIVRNITWSRVAANPALPAKILRLQFRDCFVRGTSAEKDTIPNRSLEGLDVIDEIKAELEAECPLTVSCANILVLAARDGVSFFGRAM*GVLTGRRDERVSLASEALDNLPSPASDFNTLQQQFADNGQGVPDLVVLSVAHTIGVAHCVVFAKRLFNFTGNNDTDASLDPGYTATLKAQCSSPRNTVGLDPNSSSSFDSHYFVVLFRNQGLLTSDVTLLMDKRAANFAWIYRKFNVFLA*FGHSMKKMGAIAVLTNDGG*IRKNCRAV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (stop codons in frame; PS is missing; 5' end is missing). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTATCGCGAGAGCTGTCCACGGGCTGAGGCGATCGTGAGGAACATCACGTGGAGCAGAGTGGCAGCTAACCCTGCACTACCAGCTAAGATTCTGAGGCTGCAGTTCCGCGAC
TGCTTCGTTAGGG
TACGCGCACATACAAGATCATAATGCATGTTCTCACGAGCGCAATTTAGTAGGACGATGCTTCGTAGAATTTACAGAGGAAGTGGGAAAAGATGACGAGTGAACTCG
CGTGAGGTCTTCCTGGCTAACTTATGTCACCCTAACTCATGCGTAGTACTTCACGCAAGTCATAAGCAACTATCCAATAGTTCAAAACCTGAGAAGAATGTCGCGGCTTAATGTTTACTT
CGATATCTCATGCACCTGCTCATCAAATCATGAAAGTTTGACATATATTGCGATGGACTAGCAAAATGGCTGTAGATAAAGATGCGTATGTGGGAAAAATAATTGGAACCTCTATTTGTC
AAACCAAAATGATCTCTTATTGTCCACTCATTATGTCCTCTCATCTTAAGTGTATGTTTTCGATGTTGTGACCTTTTGTACATTTGGCCTTTCCTCTATATATTTTTTACCTCTTACCAA
AAAAAAAAAAAAAGAAAAAGGGACGAGTGCTGAAAAGGACACCATTCCCAACCGGTCTCTAGAAGGACTGGATGTCATCGACGAGATAAAAGCAGAGCTCGAAGCGGAATGTCCCCTCAC
CGTCTCCTGCGCCAATATCCTTGTGCTTGCCGCTCGAGATGGCGTTTCCTTTCAG
TTACTAATTAAGAACTTACGCTTCGGCTCTTCCATGAATTGAAAAGTTGGAATTTGTGACTCTCC
ATTGCCCCTTCTAAGTAGTGAACATATAGTGACATGAATGAGAATGACGTGCGCACTTCGGAAGGGCAATGTAGGGGGTACTGACCGGGAGGAGAGATGAGAGAGTATCATTAGCTTCGG
AAGCCTTGGACAACCTTCCATCACCTGCTTCTGATTTCAACACCCTTCAGCAACAGTTTGCTGATAATGGCCAGGGAGTCCCTGATCTTGTTGTCCTTTCAG
GTTTGAAATTCACTAACT
TATATGTATTTATATATACAAATGTGGAAAATCTCTATCGTTTCTATTCATTACAAATCCTATCCAAACAATTTTATTAGATATTCCAGCCAATTTGATCACAAGATCTTTGTTTCAGTT
GCACACACCATTGGAGTGGCGCATTGCGTGGTGTTTGCCAAGAGGCTCTTCAACTTCACCGGCAACAATGACACTGACGCCTCGCTTGATCCGGGCTACACCGCCACGCTAAAGGCTCAG
TGCTCAAGCCCTCGCAACACTGTCGGGTTGGATCCCAACAGTTCCTCCTCATTTGATAGCCACTACTTCGTCGTTCTCTTCCGAAACCAAGGCCTGCTCACGTCCGACGTGACGCTGCTC
ATGGACAAGCGCGCGGCCAATTTTGCTTGGATTTACCGAAAGTTCAATGTCTTCTTGGCTTAGTTTGGTCACTCCATGAAGAAGATGGGCGCTATTGCAGTTTTAACTAATGATGGAGGA
TAAATTAGAAAGAATTGCAGGGCTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTATCGCGAGAGCTGTCCACGGGCTGAGGCGATCGTGAGGAACATCACGTGGAGCAGAGTGGCAGCTAACCCTGCACTACCAGCTAAGATTCTGAGGCTGCAGTTCCGCGAC
TGCTTCGTTAGGG
GGACGAGTGCTGAAAAGGACACCATTCCCAACCGGTCTCTAGAAGGACTGGATGTCATCGACGAGATAAAAGCAGAGCTCGAAGCGGAATGTCCCCTCACCGTCTCC
TGCGCCAATATCCTTGTGCTTGCCGCTCGAGATGGCGTTTCCTTTCAG
TTCGGAAGGGCAATGTAGGGGGTACTGACCGGGAGGAGAGATGAGAGAGTATCATTAGCTTCGGAAGCCTTG
GACAACCTTCCATCACCTGCTTCTGATTTCAACACCCTTCAGCAACAGTTTGCTGATAATGGCCAGGGAGTCCCTGATCTTGTTGTCCTTTCAG
TTGCACACACCATTGGAGTGGCGCAT
TGCGTGGTGTTTGCCAAGAGGCTCTTCAACTTCACCGGCAACAATGACACTGACGCCTCGCTTGATCCGGGCTACACCGCCACGCTAAAGGCTCAGTGCTCAAGCCCTCGCAACACTGTC
GGGTTGGATCCCAACAGTTCCTCCTCATTTGATAGCCACTACTTCGTCGTTCTCTTCCGAAACCAAGGCCTGCTCACGTCCGACGTGACGCTGCTCATGGACAAGCGCGCGGCCAATTTT
GCTTGGATTTACCGAAAGTTCAATGTCTTCTTGGCTTAGTTTGGTCACTCCATGAAGAAGATGGGCGCTATTGCAGTTTTAACTAATGATGGAGGATAAATTAGAAAGAATTGCAGGGCT
GTTAAT

Retrieve as FASTA