Entry information : SbPrx115 (Sobic.009G055100.1 [2.1] / SB09G004650 [1.4])
Entry ID 815
Creation 2006-01-06 (Christophe Dunand)
Last sequence changes 2006-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx115 (Sobic.009G055100.1 [2.1] / SB09G004650 [1.4])
Name (synonym) SbPrx115 (Sobic.009G055100.1 [2.1] / SB09G004650 [1.4])
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Ovaries
Roots
Seedlings
Inducers Acid treatment
Alkaline treatment
Colletotrichum inoculation
Ethylene treatment
Heat shock stress
Oxidative stress
Pathogen interaction
Phosphate starvation
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx115
start..stop
S start..stop
SpPrx01 719 0 1..357 1..357
ZmPrx39 631 0 3..357 2..357
SbPrx116 613 0 4..357 10..363
ZmPrx03_B73 591 0 2..357 3..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5614987..5615196 210 N° 2 5614176..5614628 453 N° 3 5613636..5614046 411  
complement(join(5613636..5614046,5614176..5614628,5614987..5615196))


exon

Literature and cross-references SbPrx115 (Sobic.009G055100.1 [2.1] / SB09G004650 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_9 (5615196..5613636)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.49940.1
Protein sequence: SbPrx115 (Sobic.009G055100.1 [2.1] / SB09G004650 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (334)
PWM (Da):   %s   37780.95 (35408.6) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.09 (7.70) Peptide Signal:   %s   cut: 24 range:24-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTKRCCLLVATLLAALLVSVTARLDVGFYNKTCPSAESIVQQTVAAAFGNSSGVAPALIRMHFHDCFVRGCDGSVLIDSTANNTAEKDSPANNPSLRFFDVVDRAKASLEAQCPGVVSCADILAFAARDSVVLTGGLGYQVPSGRRDGRVSNATQATNNLPPPFFNATQLVDRFASKNLTLEDMVVLSGAHTLGVSHCSSFAGPANLGDRLYNFSGSADGIDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDIITPDKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRNETTWKRKFAKSMVKMGKIEVLTGTQGEIRRNCRVINPASATDVLASQSGSSGFTGVAAS*

Retrieve as FASTA  
Remarks Complete sequence from 125 ESTs and from genomic (chromo 9, introns 1 and 3'). Strongly expresed! Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTAAGCGCTGCTGCCTGCTCGTCGCCACGCTCCTCGCGGCGCTGCTGGTCTCGGTCACAGCCCGCCTCGACGTCGGCTTCTACAACAAGACGTGCCCCTCCGCCGAGAGCATC
GTGCAGCAGACCGTGGCCGCCGCGTTCGGCAACAGCTCCGGCGTCGCTCCCGCGCTCATCCGCATGCACTTCCATGACTGCTTCGTCAGA
GTAAGCACGTGATTATTCATATTCATCAAA
AAAAAACAAAAGTAAGCACATGTACAACGATGTAGTATCGTCTGCAGCGTACTATATAGCTAGATACTGATCAGCATGTCCTAAATTGCAACCTCCATTGCATTTTCTTTTCTTTTTTCT
CTACATAGACTTTAGTAAGGTTTCATGTAAAGAAGTTCTTGAAAAGATAACAGTATAGAAGTATTTTGCAAGACTTTAGGTATCTAGACTAGATACATATGATTATTTCCATTCCATGTT
AGAAGTCTAGAACACGACGTCTATTCAAAAGCAGAGCAAAGAGCAAGAACTCTATACCTGAGTGACGCTTCAAATGAACTCCTTGCAGGGCTGCGACGGCTCGGTGCTGATCGACTCCAC
GGCCAACAACACGGCTGAGAAGGATTCGCCCGCCAACAACCCGAGCCTCAGGTTCTTCGACGTGGTCGACCGCGCCAAGGCGTCCCTGGAGGCGCAGTGCCCCGGCGTGGTCTCTTGCGC
CGACATCCTCGCCTTCGCGGCGAGGGACAGCGTCGTGCTCACCGGTGGCCTCGGCTACCAGGTGCCGTCCGGACGCCGTGACGGCAGGGTATCCAATGCCACCCAGGCCACGAACAACCT
GCCTCCGCCGTTTTTCAATGCCACCCAACTGGTAGACCGCTTCGCCTCCAAGAACCTCACCCTTGAGGACATGGTTGTCCTCTCCGGTGCACACACCCTCGGTGTCTCCCACTGCAGCAG
CTTCGCCGGACCTGCCAACCTGGGCGACCGGCTCTACAACTTCAGCGGCTCAGCTGACGGG
GTAATAAGAGTGACACTTCCCTCTCTGAAAAGCAAAAACTAGGCTGCTCAAGCTTCTGC
CTTTGTATTAGCGCAGTTCTTACCTCTTAGTTCTTACCTGGTTATCCATATCCACTGCTGCTGTGTACAGATTGATCCGGCGCTGAGCAAAGCCTACGCATTTCTCCTCAAGAGCATCTG
CCCGTCCAACAGCAGCCAGTTCTTCCCGAACACGACAACGTTCATGGACATCATCACACCCGACAAGTTCGACAACAAGTACTACGTCGGCCTGACCAACAACCTCGGCCTCTTTGAGTC
GGACGCTGCGCTGCTAACCAACGCAACCATGAAGGCGCTGGTGGACTCCTTTGTGCGCAACGAGACCACATGGAAGAGGAAGTTTGCCAAGTCCATGGTCAAGATGGGGAAGATCGAGGT
GCTCACCGGGACGCAGGGCGAGATCAGGCGCAACTGCAGGGTTATCAACCCTGCTAGCGCCACCGATGTTCTTGCCAGTCAGTCAGGTTCTTCAGGATTCACTGGAGTGGCTGCAAGTTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACTAAGCGCTGCTGCCTGCTCGTCGCCACGCTCCTCGCGGCGCTGCTGGTCTCGGTCACAGCCCGCCTCGACGTCGGCTTCTACAACAAGACGTGCCCCTCCGCCGAGAGCATC
GTGCAGCAGACCGTGGCCGCCGCGTTCGGCAACAGCTCCGGCGTCGCTCCCGCGCTCATCCGCATGCACTTCCATGACTGCTTCGTCAGA
GGCTGCGACGGCTCGGTGCTGATCGACTCC
ACGGCCAACAACACGGCTGAGAAGGATTCGCCCGCCAACAACCCGAGCCTCAGGTTCTTCGACGTGGTCGACCGCGCCAAGGCGTCCCTGGAGGCGCAGTGCCCCGGCGTGGTCTCTTGC
GCCGACATCCTCGCCTTCGCGGCGAGGGACAGCGTCGTGCTCACCGGTGGCCTCGGCTACCAGGTGCCGTCCGGACGCCGTGACGGCAGGGTATCCAATGCCACCCAGGCCACGAACAAC
CTGCCTCCGCCGTTTTTCAATGCCACCCAACTGGTAGACCGCTTCGCCTCCAAGAACCTCACCCTTGAGGACATGGTTGTCCTCTCCGGTGCACACACCCTCGGTGTCTCCCACTGCAGC
AGCTTCGCCGGACCTGCCAACCTGGGCGACCGGCTCTACAACTTCAGCGGCTCAGCTGACGGG
ATTGATCCGGCGCTGAGCAAAGCCTACGCATTTCTCCTCAAGAGCATCTGCCCGTCC
AACAGCAGCCAGTTCTTCCCGAACACGACAACGTTCATGGACATCATCACACCCGACAAGTTCGACAACAAGTACTACGTCGGCCTGACCAACAACCTCGGCCTCTTTGAGTCGGACGCT
GCGCTGCTAACCAACGCAACCATGAAGGCGCTGGTGGACTCCTTTGTGCGCAACGAGACCACATGGAAGAGGAAGTTTGCCAAGTCCATGGTCAAGATGGGGAAGATCGAGGTGCTCACC
GGGACGCAGGGCGAGATCAGGCGCAACTGCAGGGTTATCAACCCTGCTAGCGCCACCGATGTTCTTGCCAGTCAGTCAGGTTCTTCAGGATTCACTGGAGTGGCTGCAAGTTAA

Retrieve as FASTA