Entry information : EgrPrx[P]79
Entry ID 8169
Creation 2011-03-01 (Christophe Dunand)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EgrPrx[P]79
Name EgrPrx[P]79
Class Class III peroxidase     [Orthogroup: Prx034]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]79
start..stop
S start..stop
EcamPrx78 270 3e-92 1..146 13..158
EgrPrx81 268 2e-91 1..146 13..158
EglPrx81 268 2e-91 1..146 13..158
EguPrx78 267 6e-91 1..146 13..158
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42505293..42505530 238 N° 2 42504543..42504769 227  
complement(join(42504543..42504769,42505293..42505530))


exon

Literature and cross-references EgrPrx[P]79
DNA ref. Phytozome 12:   scaffold_5 (42505530..42504543)
Protein sequence: EgrPrx[P]79
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   154 (133)
PWM (Da):   %s   16454.44 (14235.3)  
PI (pH):   %s   8.12 (7.96) Peptide Signal:   %s   cut: 22 range:22-154
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CSSTLFIALILICSQPNRSTAAAAADAMGRHRQMSFDYYAKSCPQVKQLIGSVTSQQFKEAPVSGPATIRLFFHDCFVEGTRGSILISSKPGSKELAEKDAIDNKDLRAEGFETIAKPKSLVENKCLGVVSCADILAIAARDFAHLVLPSTSRP

Retrieve as FASTA  
Remarks Pseudogene from genomic (part of exon 1 and exon 2). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCACCGCAGCTGCTGCCGCCGATGCCATGGGCCGCCACCGCCAGATGTCGTTTGACTACTACGCC
AAGTCGTGCCCCCAGGTCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACCATCCGGCTCTTCTTCCATGACTGCTTCGTTGAGG
TA
AAATCTCTCTCTCTCTCTCTCTCTCTCTCTCTGTGCACTTACTTTCACGTGCATGCAATGGCAGCAGAGGAAGTCAATATTCAGGCAGATGCCACTAGCAGTTGAGCAGCTCCCCACATT
TTGAGCATCTTTTGTTATCTACGGTGACCGAATCCTTGCATATTCTTGTTTCTACACGAATGAGTCCGTGTACAACATCACTAATAAGAAATTACAGTTTTCATCGGCTAATCTTACCAA
AAATTCAATTCAACCCTCCGGTGAGTGTTTCGTGTTTTGTTATTATTGCATTCCCCGAACCCGCCACAACTGTCAATCAAAGTCGGCCAGGCATGGGTCCCGAGTCGATAATTCTCTTCA
TTTTCATAGCAAGCGAGAGAAATTACCATGAAAAACATGGAGAATCATCAACTAGCGAGATTACTATCGGTAAACGCCGTTCATTTGTTAATCGATCGAGTAGGGCGATAATCCTAGCGT
AGAAACTACTGACTCTGCATGAGTTATGACCACTGTGGAAGGGACGCGAGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGA
TTTGAGGGCGGAGGGATTCGAGACAATCGCGAAACCCAAGTCCTTGGTGGAAAATAAATGCCTCGGCGTCGTTTCTTGTGCTGACATTCTTGCCATCGCTGCCAGAGACTTTGCCCACCT
GGTACTTCCATCAACCTCTCGTCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCATCGACCCTTTTCATCGCCCTCATCCTCATATGCAGCCAGCCGAACCGATCCACCGCAGCTGCTGCCGCCGATGCCATGGGCCGCCACCGCCAGATGTCGTTTGACTACTACGCC
AAGTCGTGCCCCCAGGTCAAGCAACTCATCGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCCGGGCCGGCCACCATCCGGCTCTTCTTCCATGACTGCTTCGTTGAGG
GG
ACGCGAGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACAATCGCGAAACCCAAGTCC
TTGGTGGAAAATAAATGCCTCGGCGTCGTTTCTTGTGCTGACATTCTTGCCATCGCTGCCAGAGACTTTGCCCACCTGGTACTTCCATCAACCTCTCGTCCTTAG

Retrieve as FASTA