Entry information : SbPrx125 (Sobic.009G145700.1 [2.1] / Sb09g021050 [1.4])
Entry ID 817
Creation 2005-12-28 (Christophe Dunand)
Last sequence changes 2005-12-28 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx125 (Sobic.009G145700.1 [2.1] / Sb09g021050 [1.4])
Name (synonym) SbPrx125 (Sobic.009G145700.1 [2.1] / Sb09g021050 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Roots
Inducers Acid treatment
Alkaline treatment
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx125
start..stop
S start..stop
SbPrx123 598 0 1..316 1..316
SbPrx124 597 0 1..320 1..323
SiPrx101 515 0 13..319 14..316
SbPrx120 503 0 1..317 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50483025..50483273 249 N° 2 50483380..50483574 195 N° 3 50483686..50483848 163 N° 4 50483973..50484328 356
join(50483025..50483273,50483380..50483574,50483686..50483848,50483973..50484328 )


exon

Literature and cross-references SbPrx125 (Sobic.009G145700.1 [2.1] / Sb09g021050 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_9 (50483025..50484328)
Protein sequence: SbPrx125 (Sobic.009G145700.1 [2.1] / Sb09g021050 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (288)
PWM (Da):   %s   34296.46 (31167.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.33 (8.01) Peptide Signal:   %s   cut: 33 range:33-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSRVSSPGWLLAAHCALLLALLLAGAARGHAGAALSSAFYDQSCPGAYNVVRRVIQSARVSDPRIPASLIRLHFHDCFVNGCDGSLLLDDDLPAIQTEKNVPANNNSARGFPVVDGIKRALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDGTTTNVQSAKNLPSPFDSLAKLQEKFRNVNLDDTDLVALQGAHTFGKVQCQFTRHNCSAGQPQGALEDLDQVTPTVFDNKYYGNLLHGQAQLPSDQVMLSDPTAPRTTAPVVHRFASNQKDFFTNFVTSMIKMGNISPLTGKDGEIRKNCRRVNRKGN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 2 EST (Stop at position 219).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCGTCTCGTCTCCTGGGTGGCTGTTAGCCGCGCACTGCGCTCTCCTGCTCGCCCTCCTGCTGGCTGGAGCCGCCCGTGGCCACGCCGGCGCGGCGCTGAGCTCC
GCGTTCTATGACCAGTCGTGCCCCGGCGCCTACAACGTCGTCCGTCGCGTCATCCAGAGCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTCCATGACTGC
TTCGTCAAC
GTACGTGAGCTGCTGATCAATGCAATTGTGCTCGTGTAGCATGCATGTACGCGGCAGTGCATGCCTTTCATCATCTGACATGAACGAACGTTGAATAATGTTTCAGGGCTG
CGATGGCTCTCTTCTTCTGGATGACGATCTCCCGGCGATCCAGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGTTTCCCGGTAGTCGACGGCATCAAGCGCGCGCTGGA
GGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCAGAGATCTCAGTTGAACTC
GTAAGCGTCTCCTGTATATATATATCCTGTTGCATTCAAACTCTGCCTAT
AGCTTCTCGCCTGAAGAGAGGGGACGACACTGACGGAAAAGAATCGTGCACGTAACTGTAGGCTGGAGGACCACGGTGGAGGGTGCTTCTTGGCCGGCGAGACGGCACCACGACCAACGT
CCAGAGCGCCAAGAACCTTCCCAGCCCTTTCGACTCCCTTGCCAAGCTCCAGGAGAAGTTCAGAAACGTCAACCTGGACGACACTGATCTCGTTGCCCTCCAAG
GTAATTGCACGTAATA
CTGAATAATTGATAGTAGCAATATAAATTTATAGTACGAACAGTTGAAACTTGCGAAGTTTTTATACGGGTGCACACTGATGATATCAACAACAAATTTCTACTACAGGAGCGCACACAT
TCGGCAAAGTCCAGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGCGCACTAGAGGACCTAGACCAAGTTACACCCACCGTGTTTGACAACAAGTATTATGGCAACC
TCTTGCACGGCCAAGCGCAGTTGCCGTCCGACCAGGTTATGCTATCCGACCCTACGGCACCGAGAACCACTGCACCTGTTGTTCACCGGTTCGCGAGCAACCAAAAGGATTTTTTCACGA
ACTTTGTGACATCCATGATTAAGATGGGGAACATCAGCCCGCTGACAGGGAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATAGAAAAGGCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCGTCTCGTCTCCTGGGTGGCTGTTAGCCGCGCACTGCGCTCTCCTGCTCGCCCTCCTGCTGGCTGGAGCCGCCCGTGGCCACGCCGGCGCGGCGCTGAGCTCC
GCGTTCTATGACCAGTCGTGCCCCGGCGCCTACAACGTCGTCCGTCGCGTCATCCAGAGCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTCCATGACTGC
TTCGTCAAC
GGCTGCGATGGCTCTCTTCTTCTGGATGACGATCTCCCGGCGATCCAGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGTTTCCCGGTAGTCGACGGCATC
AAGCGCGCGCTGGAGGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCAGAGATCTCAGTTGAACTC
GCTGGAGGACCACGGTGGAGGGTGCTTCTTGGCCGG
CGAGACGGCACCACGACCAACGTCCAGAGCGCCAAGAACCTTCCCAGCCCTTTCGACTCCCTTGCCAAGCTCCAGGAGAAGTTCAGAAACGTCAACCTGGACGACACTGATCTCGTTGCC
CTCCAAG
GAGCGCACACATTCGGCAAAGTCCAGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGCGCACTAGAGGACCTAGACCAAGTTACACCCACCGTGTTTGAC
AACAAGTATTATGGCAACCTCTTGCACGGCCAAGCGCAGTTGCCGTCCGACCAGGTTATGCTATCCGACCCTACGGCACCGAGAACCACTGCACCTGTTGTTCACCGGTTCGCGAGCAAC
CAAAAGGATTTTTTCACGAACTTTGTGACATCCATGATTAAGATGGGGAACATCAGCCCGCTGACAGGGAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATAGAAAAGGCAAT
TGA

Retrieve as FASTA