Entry information : EgrPrx84 ( Eucgr.E03716 / Egrandis_v1_0.019243m)
Entry ID 8177
Creation 2011-03-03 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EgrPrx84 ( Eucgr.E03716 / Egrandis_v1_0.019243m)
Name (synonym) EgrPrx84 ( Eucgr.E03716 / Egrandis_v1_0.019243m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx84
start..stop
S start..stop
EguPrx88 670 0 1..327 1..327
EguPrx84 670 0 1..327 1..327
EcamPrx84 667 0 1..327 1..327
EgrPrx82 653 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65106127..65106351 225 N° 2 65105680..65105865 186 N° 3 65105242..65105407 166 N° 4 65104660..65105066 407
complement(join(65104660..65105066,65105242..65105407,65105680..65105865,6510612 7..65106351))


exon

Literature and cross-references EgrPrx84 ( Eucgr.E03716 / Egrandis_v1_0.019243m)
DNA ref. Phytozome 11:   scaffold_5 (65106351..65104660)
Protein sequence: EgrPrx84 ( Eucgr.E03716 / Egrandis_v1_0.019243m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35253.07 (32238.5)  
PI (pH):   %s   8.25 (8.38) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVMDQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAPPNFSLRGYQVIDRVKTALEKACPGTVSCADVLAIVARDVVVATGALSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMKGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSETKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTCGCCCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GTAAGTGAATGAATG
AGTGCACGTACTTCTCTTCCTACTTGTGCTTGGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAGAGAATGGTTTTTACTTTCGTCGAACCATCTGCTAAACATCAATTAGA
ACAGGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACATACTTTCCTAGATTCGTCCGTGGATACGAACTGTTTTCTGCATGAACTCACAGTCGAATAGTGTTTCTTTCTGGGTTTTT
CCACAGGGTTGCGAAGGTTCAATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCACCGTTTCGTGTGCTGACGTCTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
GTGCGCATATGCATATGTCACTTGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCAGTAGAAATCTCGATTTTCACAAACAATCCATCCCCTCTCATTGGAAAAAAAATTCCGCCCATACGTATCTTCGGATCTAATTACTGCTTGTCAA
AACCGAGATTATTTTTGCATCGTGCATCATGAAACTCAATGATTTTTCCATCAGAGAAAAACATATTTATATAGGAATTGGGTTTCTTTTTGTTGTCACTTTAGACCGGAGCACTTTCCT
ATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAACGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAAGGGCC
TCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAACACTTAATCTTCAATTGCTTCATATGCTTTATCGATTATTTTGTGGAAATTGACATAGATTAATAGGAAGAAACTATAATTTGAGC
ACGAGATTCATAAACAGTCTGCACTGCAAGGAGAAAACGTAATTTGTAAAGTCAGATCATGCTAATTCTGATTTCTGTTGACTAGGTGGCCACACCCTTGGAACTTCACACTGCTCTTCC
TTCTCCGACCGCCTATACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTGAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTCGTTGAG
ATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAATACTTCGATCTGATCCCGAAGAGAAGAGGACTCTTCACTTCGGACGCCGCACTTCTTGATGATAGCGAAACCAAGGCGTACATT
GACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTGCA
AAGGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTCGCCCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCACC
GTTTCGTGTGCTGACGTCTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
ACCGGAGCACTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAACGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAAGGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTATACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTGAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTCGTTGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAATACTTCGATCTGATCCCGAAGAGAAGAGGACTCTTCACTTCGGACGCCGCACTTCTTGATGATAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAATTGA

Retrieve as FASTA